D0A4N5 · D0A4N5_TRYB9
- ProteinHeat shock protein 83
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids704 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 32 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 36 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 78 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 83 | ATP (UniProtKB | ChEBI) | ||||
Sequence: M | ||||||
Binding site | 91 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 98-99 | ATP (UniProtKB | ChEBI) | ||||
Sequence: SG | ||||||
Binding site | 118-123 | ATP (UniProtKB | ChEBI) | ||||
Sequence: QFGVGF | ||||||
Binding site | 169 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 375 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | protein-containing complex | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | ATP-dependent protein folding chaperone | |
Molecular Function | unfolded protein binding | |
Biological Process | cellular response to heat | |
Biological Process | protein stabilization |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Discoba > Euglenozoa > Kinetoplastea > Metakinetoplastina > Trypanosomatida > Trypanosomatidae > Trypanosoma
Accessions
- Primary accessionD0A4N5
Proteomes
Organism-specific databases
Subcellular Location
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 25-179 | Histidine kinase/HSP90-like ATPase | ||||
Sequence: NKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDCDLKRGTRIVLHLKEDQ | ||||||
Region | 210-252 | Disordered | ||||
Sequence: TTEKEVTDEDEDEEAAKKAEEGEEPKVEEVKDGDDADAKKKKT | ||||||
Compositional bias | 213-227 | Acidic residues | ||||
Sequence: KEVTDEDEDEEAAKK | ||||||
Compositional bias | 228-252 | Basic and acidic residues | ||||
Sequence: AEEGEEPKVEEVKDGDDADAKKKKT | ||||||
Coiled coil | 526-553 | |||||
Sequence: FEETEEEKKQREEEKASYERLCKAMKEV | ||||||
Region | 678-704 | Disordered | ||||
Sequence: EEEEAQAPVAAAAANSSTGASGMEEVD | ||||||
Compositional bias | 688-704 | Polar residues | ||||
Sequence: AAAANSSTGASGMEEVD |
Sequence similarities
Belongs to the heat shock protein 90 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length704
- Mass (Da)80,777
- Last updated2009-11-24 v1
- ChecksumF200F91B2D1AC176
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 213-227 | Acidic residues | ||||
Sequence: KEVTDEDEDEEAAKK | ||||||
Compositional bias | 228-252 | Basic and acidic residues | ||||
Sequence: AEEGEEPKVEEVKDGDDADAKKKKT | ||||||
Compositional bias | 688-704 | Polar residues | ||||
Sequence: AAAANSSTGASGMEEVD |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FN554973 EMBL· GenBank· DDBJ | CBH16229.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FN554973 EMBL· GenBank· DDBJ | CBH16230.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FN554973 EMBL· GenBank· DDBJ | CBH16231.1 EMBL· GenBank· DDBJ | Genomic DNA |