C9JW19 · C9JW19_HUMAN
- ProteinTransmembrane BAX inhibitor motif containing 1
- GeneTMBIM1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids167 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | membrane |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionC9JW19
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 102-123 | Helical | ||||
Sequence: VYSIISVQLLITVAIIAIFTFV | ||||||
Transmembrane | 135-154 | Helical | ||||
Sequence: AVYYVSYAVFVVTYLILACC |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 199 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 2 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 81 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 83 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-28 | Pro residues | ||||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQ | ||||||
Region | 1-37 | Disordered | ||||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYP | ||||||
Compositional bias | 50-65 | Pro residues | ||||
Sequence: PAGYPQPMPPTHPMPM | ||||||
Region | 50-73 | Disordered | ||||
Sequence: PAGYPQPMPPTHPMPMNYGPGHGY |
Sequence similarities
Belongs to the BI1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length167
- Mass (Da)18,498
- Last updated2009-11-03 v1
- Checksum549634BEA2843BAC
Computationally mapped potential isoform sequences
There are 15 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q969X1 | LFG3_HUMAN | TMBIM1 | 311 | ||
C9IZ27 | C9IZ27_HUMAN | TMBIM1 | 150 | ||
C9IYT2 | C9IYT2_HUMAN | TMBIM1 | 107 | ||
F8WDY4 | F8WDY4_HUMAN | TMBIM1 | 140 | ||
C9JWV9 | C9JWV9_HUMAN | TMBIM1 | 171 | ||
B4DUD2 | B4DUD2_HUMAN | TMBIM1 | 215 | ||
C9JN47 | C9JN47_HUMAN | TMBIM1 | 73 | ||
C9JM62 | C9JM62_HUMAN | TMBIM1 | 46 | ||
C9JI44 | C9JI44_HUMAN | TMBIM1 | 84 | ||
C9JEN3 | C9JEN3_HUMAN | TMBIM1 | 106 | ||
C9JDV0 | C9JDV0_HUMAN | TMBIM1 | 90 | ||
C9JAK9 | C9JAK9_HUMAN | TMBIM1 | 67 | ||
C9JAP5 | C9JAP5_HUMAN | TMBIM1 | 91 | ||
B3KSM0 | B3KSM0_HUMAN | TMBIM1 | 137 | ||
A0A1D5RMQ2 | A0A1D5RMQ2_HUMAN | TMBIM1 | 8 |
Features
Showing features for compositional bias, non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-28 | Pro residues | ||||
Sequence: MSNPSAPPPYEDRNPLYPGPPPPGGYGQ | ||||||
Compositional bias | 50-65 | Pro residues | ||||
Sequence: PAGYPQPMPPTHPMPM | ||||||
Non-terminal residue | 167 | |||||
Sequence: L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC021016 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |