C9EI97 · C9EI97_JATCU
- Proteinacetyl-CoA carboxytransferase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids770 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
Catalytic activity
- acetyl-CoA + N6-carboxybiotinyl-L-lysyl-[protein] = malonyl-CoA + N6-biotinyl-L-lysyl-[protein]
Pathway
Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acetyl-CoA carboxylase complex | |
Molecular Function | acetyl-CoA carboxylase activity | |
Molecular Function | ATP binding | |
Molecular Function | carboxyl- or carbamoyltransferase activity | |
Biological Process | fatty acid biosynthetic process | |
Biological Process | malonyl-CoA biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameacetyl-CoA carboxytransferase
- EC number
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Malpighiales > Euphorbiaceae > Crotonoideae > Jatropheae > Jatropha
Accessions
- Primary accessionC9EI97
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 127-381 | CoA carboxyltransferase C-terminal | ||||
Sequence: SLENKYQQALKDLYTHLTPIQRVNIARHPNRPTFLDHVFSITDKFVELHGDRAGYDDPAIVTGIGTIDGRRYMFMGHQKGRNTKENIMRNFGMPTPHGYRKALRMMYYADHHGFPIVTFIDTPGAFADLKSEELGQGEAIAHNLRTMFGLKVPIVSIVIGEGGSGGALAIGCANKLLMLENAVFYVASPEACAAILWKSAKASPKAAEKLKITATELCKLQIADGVIPEPLGGAHADPSWTSQQIKNAIKESMDE | ||||||
Region | 740-770 | Disordered | ||||
Sequence: GSLKNDDSREGVSKHDESRVEINLGANRTFA | ||||||
Compositional bias | 742-761 | Basic and acidic residues | ||||
Sequence: LKNDDSREGVSKHDESRVEI |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length770
- Mass (Da)86,074
- Last updated2009-11-03 v1
- ChecksumE79D8DD5B4F01A75
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 742-761 | Basic and acidic residues | ||||
Sequence: LKNDDSREGVSKHDESRVEI |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GQ845013 EMBL· GenBank· DDBJ | ACV91932.1 EMBL· GenBank· DDBJ | mRNA |