C8BLE7 · C8BLE7_HCMV
- ProteinTegument protein UL51 homolog
- GeneUL71
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids361 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Plays several roles during the time course of infection, including egress of virus particles from the perinuclear space and secondary envelopment of cytoplasmic capsids that bud into specific trans-Golgi network (TGN)-derived membranes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | host cell Golgi apparatus |
Names & Taxonomy
Protein names
- Recommended nameTegument protein UL51 homolog
Gene names
Organism names
- Strains
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Betaherpesvirinae > Cytomegalovirus > Cytomegalovirus humanbeta5
- Virus hosts
Accessions
- Primary accessionC8BLE7
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 251-299 | Disordered | ||||
Sequence: GDEEDEVTVMSPSPEPVQQQPPVEPVQQQPQGRGSHRRRYKESAPQETL | ||||||
Compositional bias | 285-299 | Basic and acidic residues | ||||
Sequence: SHRRRYKESAPQETL |
Sequence similarities
Belongs to the herpesviridae UL51 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length361
- Mass (Da)39,860
- Last updated2010-11-30 v1
- Checksum27E5EF8F36298BD6
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 285-299 | Basic and acidic residues | ||||
Sequence: SHRRRYKESAPQETL |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GQ221975 EMBL· GenBank· DDBJ | ACS92161.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
GU179001 EMBL· GenBank· DDBJ | ACZ72814.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JX512204 EMBL· GenBank· DDBJ | AFR55724.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JX512205 EMBL· GenBank· DDBJ | AFR55890.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM192298 EMBL· GenBank· DDBJ | AII79505.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM192299 EMBL· GenBank· DDBJ | AII79673.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM192300 EMBL· GenBank· DDBJ | AII79838.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM192301 EMBL· GenBank· DDBJ | AII79997.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM192302 EMBL· GenBank· DDBJ | AII80164.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745644 EMBL· GenBank· DDBJ | AKI09460.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745647 EMBL· GenBank· DDBJ | AKI09965.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745650 EMBL· GenBank· DDBJ | AKI10468.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745651 EMBL· GenBank· DDBJ | AKI10635.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745662 EMBL· GenBank· DDBJ | AKI12466.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745664 EMBL· GenBank· DDBJ | AKI12797.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745684 EMBL· GenBank· DDBJ | AKI16144.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745708 EMBL· GenBank· DDBJ | AKI20156.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745711 EMBL· GenBank· DDBJ | AKI20659.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745714 EMBL· GenBank· DDBJ | AKI21162.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745718 EMBL· GenBank· DDBJ | AKI21827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KP745728 EMBL· GenBank· DDBJ | AKI23496.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT726942 EMBL· GenBank· DDBJ | AMJ52930.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT726952 EMBL· GenBank· DDBJ | AMJ54599.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LR131944 EMBL· GenBank· DDBJ | VDY02784.1 EMBL· GenBank· DDBJ | Genomic DNA |