C7YS44 · PGH_FUSV7
- ProteinPolyglycine hydrolase
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids636 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Serine-type endopeptidase that cleaves Gly-Gly bonds in the polyglycine linker of host plant class IV chitinases to disrupt their chitin-binding, and thereby plays a role in lowering the defense responses of the host to the fungus (PubMed:36762862).
Degrades Z.mays Endochitinase A (CHIA) in vitro, although corn is not its host species (PubMed:35240278, PubMed:36762862).
Degrades Z.mays Endochitinase A (CHIA) in vitro, although corn is not its host species (PubMed:35240278, PubMed:36762862).
Catalytic activity
- a glycyl-glycyl-[protein] + H2O = [protein]-C-terminal glycine + N-terminal glycyl-[protein]
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 363 | |||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | serine-type endopeptidase activity | |
Biological Process | effector-mediated suppression of host defense response |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePolyglycine hydrolase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Hypocreales > Nectriaceae > Fusarium > Fusarium solani species complex > Fusarium vanettenii
Accessions
- Primary accessionC7YS44
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 554 | Decreases protein level with no apparent gain of beta-lactamase activity; when associated with 583-K--T-584. | ||||
Sequence: F → G | ||||||
Mutagenesis | 583-584 | Decreases protein level with no apparent gain of beta-lactamase activity; when associated with G-554. | ||||
Sequence: RD → KT |
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MHSLSLRRLLTSVLSLCSCSSA | ||||||
Chain | PRO_5002988623 | 23-636 | Polyglycine hydrolase | |||
Sequence: LPNQRRSNVTSHVETYYSVDGATHAEKSKALKADGYRIVSLSSYGSPDSANYAAIWVQEEGPSFEIIHDADEATYNSWLQTWKSRGYVSTQVSATGPAENAVFAGVMENINVANWFQSCELENPWAFSNTTGNVDVVVKGFRMFGTPEERRYCILGHENVGNEQTTIQYSTPSFTVNFASTFEAETTKRFWRPSRLFLSEDHIITPSFADTSVGKWSHAVDLTKAELKEKIETERAKGLYPIDIQGGGSGSSERFTVVFAERTSPKPRQWNVRGEITGFEDNKAAEEEVDSIMRRFMEKNGVRQAQFAVALEGKTIAERSYTWAEDDRAIVEPDDIFLLASVSKMFLHASIDWLVSHDMLNFSTPVYDLLGYKPADSRANDINVQHLLDHSAGYDRSMSGDPSFMFREIAQSLPTKGAKAATLRDVIEYVVAKPLDFTPGDYSAYSNYCPMLLSYVVTNITGVPYLDFLEKNILDGLNVRLYETAASKHTEDRIVQESKNTGQDPVHPQSAKLVPGPHGGDGAVKEECAGTFAMAASASSLAKFIGSHAVWGTGGRVSSNRDGSLSGARAYVESRGTIDWALTLNTREYISETEFDELRWYSLPDFLSAFPIAG | ||||||
Glycosylation | 30 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 141↔175 | |||||
Sequence: CELENPWAFSNTTGNVDVVVKGFRMFGTPEERRYC | ||||||
Glycosylation | 151 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 383 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 481 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 512-540 | Disordered | ||||
Sequence: TEDRIVQESKNTGQDPVHPQSAKLVPGPH |
Sequence similarities
Belongs to the peptidase S12 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length636
- Mass (Da)70,412
- Last updated2009-10-13 v1
- Checksum029A04BD0E26D0A1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GG698899 EMBL· GenBank· DDBJ | EEU45181.1 EMBL· GenBank· DDBJ | Genomic DNA |