C4R7H2 · C4R7H2_KOMPG
- ProteinTranscription elongation factor Spt6
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1500 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Plays a role in maintenance of chromatin structure during RNA polymerase II transcription elongation thereby repressing transcription initiation from cryptic promoters. Mediates the reassembly of nucleosomes onto the promoters of at least a selected set of genes during repression; the nucleosome reassembly is essential for transcriptional repression.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | pericentric heterochromatin | |
Cellular Component | transcription elongation factor complex | |
Molecular Function | DNA binding | |
Molecular Function | histone binding | |
Molecular Function | nucleosome binding | |
Molecular Function | translation elongation factor activity | |
Biological Process | nucleosome organization | |
Biological Process | transcription elongation-coupled chromatin remodeling |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription elongation factor Spt6
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Pichiaceae > Komagataella
Accessions
- Primary accessionC4R7H2
Proteomes
Subcellular Location
Interaction
Protein-protein interaction databases
Family & Domains
Features
Showing features for compositional bias, region, coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-47 | Polar residues | ||||
Sequence: MSAPSPSVSEEDINETRNSIDADASTVQDLLDQDAQEGSGSDNEGSN | ||||||
Region | 1-216 | Disordered | ||||
Sequence: MSAPSPSVSEEDINETRNSIDADASTVQDLLDQDAQEGSGSDNEGSNIVDSSEEDDDEDDEEEMQKVREGFIVDDDDENDEDGIPSSTKRKHRKKHKKRSAEVVEEVDEDDLQLLMENSGAVPGQQQNVKFKRLKRAEQDEKAQDSDSRGLNDMFSDEEGPGGVVEEGSEEEGLEDNLTTKTQRSGNLPHDEFDDFIEEDEFSDEDDEARDERLAR | ||||||
Compositional bias | 48-64 | Acidic residues | ||||
Sequence: IVDSSEEDDDEDDEEEM | ||||||
Compositional bias | 131-154 | Basic and acidic residues | ||||
Sequence: FKRLKRAEQDEKAQDSDSRGLNDM | ||||||
Compositional bias | 193-208 | Acidic residues | ||||
Sequence: FDDFIEEDEFSDEDDE | ||||||
Coiled coil | 1121-1148 | |||||
Sequence: RSTLQIIKEELQSRYREIRRDFHILNEA | ||||||
Domain | 1165-1235 | S1 motif | ||||
Sequence: GMVIPVYVRKVESSYMSVSTQSLIAGNIQRQDILEPNDRRDPREVYSVGQTVRACILDVDYYNFKCQLSLL |
Sequence similarities
Belongs to the SPT6 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,500
- Mass (Da)172,815
- Last updated2009-07-07 v1
- Checksum0FD251779296A6F0
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-47 | Polar residues | ||||
Sequence: MSAPSPSVSEEDINETRNSIDADASTVQDLLDQDAQEGSGSDNEGSN | ||||||
Compositional bias | 48-64 | Acidic residues | ||||
Sequence: IVDSSEEDDDEDDEEEM | ||||||
Compositional bias | 131-154 | Basic and acidic residues | ||||
Sequence: FKRLKRAEQDEKAQDSDSRGLNDM | ||||||
Compositional bias | 193-208 | Acidic residues | ||||
Sequence: FDDFIEEDEFSDEDDE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FN392322 EMBL· GenBank· DDBJ | CAY71547.1 EMBL· GenBank· DDBJ | Genomic DNA |