C4QYQ8 · C4QYQ8_KOMPG
- ProteinFACT complex subunit
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1005 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | FACT complex | |
Molecular Function | histone chaperone activity | |
Molecular Function | nucleosome binding | |
Biological Process | constitutive heterochromatin formation | |
Biological Process | DNA repair | |
Biological Process | DNA replication | |
Biological Process | nucleosome organization | |
Biological Process | transcription elongation by RNA polymerase II |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameFACT complex subunit
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Phaffomycetaceae > Komagataella
Accessions
- Primary accessionC4QYQ8
Proteomes
Subcellular Location
Interaction
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-165 | FACT complex subunit Spt16 N-terminal lobe | ||||
Sequence: IDPVAFKNRLGAIQRKLNSSNEIFQGITTLLVVVGSSDESNPYKKSTILHNWLLGYEFPATALAITKNSITFLTSVGKAKYLTPLQNVTTVKILARNKDSEHNEALFDQFIDQLKSSVDDSKRLGVITKDKFTGSFYQDWLKKWDAAKSDFELVDVATGL | ||||||
Compositional bias | 441-464 | Basic and acidic residues | ||||
Sequence: EGEDKKPRVKDEPTSRKIEKPEVS | ||||||
Region | 441-489 | Disordered | ||||
Sequence: EGEDKKPRVKDEPTSRKIEKPEVSAPARGSKILKSKLRNETTNTEEEKE | ||||||
Compositional bias | 473-489 | Basic and acidic residues | ||||
Sequence: LKSKLRNETTNTEEEKE | ||||||
Domain | 547-698 | FACT complex subunit Spt16 | ||||
Sequence: ISIDPKAQTIILPICGRPVPFHINSFKNGSKNEEGDYMYIRLNFNSPGMGSSVKKTELPYEDGDDKEFVRSLTFRSTNKERMSEVFKAITELKKTAVKRDQERKTMEDVVAQAQLVEFKGRPKKLENVFVRPAPDSKRVTGTLFIHQNGIRY | ||||||
Domain | 821-911 | Histone chaperone RTT106/FACT complex subunit SPT16-like middle | ||||
Sequence: FTGVPFRSSVLCLPTRDCLIQLIDTPFLVVTLEEIEVAHLERVQFGLKNFDLVFVFKDFSKPVVHINTIPIEMLEFVKQWLTDVDIPYSEG | ||||||
Region | 940-1005 | Disordered | ||||
Sequence: LGGGESDDEESEEEESEFQVSDEDPEDEDVSEEYSAAEDGSDFSEEDDSEGSIAGSEDESEEEFSD | ||||||
Compositional bias | 944-1005 | Acidic residues | ||||
Sequence: ESDDEESEEEESEFQVSDEDPEDEDVSEEYSAAEDGSDFSEEDDSEGSIAGSEDESEEEFSD |
Sequence similarities
Belongs to the peptidase M24 family. SPT16 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,005
- Mass (Da)114,856
- Last updated2009-07-07 v1
- Checksum6C74A8C4B572B8E8
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 441-464 | Basic and acidic residues | ||||
Sequence: EGEDKKPRVKDEPTSRKIEKPEVS | ||||||
Compositional bias | 473-489 | Basic and acidic residues | ||||
Sequence: LKSKLRNETTNTEEEKE | ||||||
Compositional bias | 944-1005 | Acidic residues | ||||
Sequence: ESDDEESEEEESEFQVSDEDPEDEDVSEEYSAAEDGSDFSEEDDSEGSIAGSEDESEEEFSD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FN392319 EMBL· GenBank· DDBJ | CAY68382.1 EMBL· GenBank· DDBJ | Genomic DNA |