C0Z2W8 · C0Z2W8_ARATH
- ProteinAT4G38420 protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids346 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | copper ion binding | |
Molecular Function | oxidoreductase activity |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Viridiplantae > Streptophyta > Streptophytina > Embryophyta > Tracheophyta > Euphyllophyta > Spermatophyta > Magnoliopsida (flowering plants) > Mesangiospermae > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae (mustard family) > Camelineae > Arabidopsis
Accessions
- Primary accessionC0Z2W8
PTM/Processing
Keywords
- PTM
Structure
3D structure databases
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-96 | Plastocyanin-like | ||||
Sequence: SITVHKGKTYRFRISNVGLQHTLNFRIQGHQMKLVEVEGTHTVQSMYTSLDIHVGQSYSVLVTMDQPDQDYDIVVSTKFVAKKLLVSSTIHYSN | ||||||
Domain | 181-319 | Plastocyanin-like | ||||
Sequence: DTPLKLADYFKIKGVFKMGSIPDKPRRGRGMRMETSVMGAHHRDFLEIIFQNREKIVQSYHLDGYSFWVVGTDRGTWSKASRREYNLRDAISRSTTQVYPESWTAVYVALDNVGMWNLRSEYWARQYLGQQFYLRVYSP |
Sequence similarities
Belongs to the multicopper oxidase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length346
- Mass (Da)39,610
- Last updated2009-05-26 v1
- Checksum6EF375A59F32FB71