C0SPC1 · CCRZ_BACSU
- ProteinCell cycle regulator CcrZ
- GeneccrZ
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids269 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in cell cycle regulation and chromosome integrity. Activates DnaA-dependent chromosomal DNA replication initiation ensuring that the chromosome is replicated at the right time during the cell cycle (By similarity).
May regulate replication initiation through phosphorylation of a possible second messenger or metabolite, and by interacting with replication initiation proteins. Has ATPase activity with D-ribose and 2-deoxy-D-ribose in vitro, but not with choline. Involved in DNA damage response (PubMed:35576203).
May regulate replication initiation through phosphorylation of a possible second messenger or metabolite, and by interacting with replication initiation proteins. Has ATPase activity with D-ribose and 2-deoxy-D-ribose in vitro, but not with choline. Involved in DNA damage response (PubMed:35576203).
Catalytic activity
- ATP + D-ribose = ADP + D-ribose 5-phosphate + H+
Activity regulation
Activated by D-ribose and 2-deoxy-D-ribose. Slightly activated by kanamycin and gentamicin.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 39 | ATP (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 76 | ATP (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 77 | ATP (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Binding site | 78 | ATP (UniProtKB | ChEBI) | ||||
Sequence: M | ||||||
Binding site | 80 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Active site | 166 | Proton acceptor | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | ATP binding | |
Molecular Function | carbohydrate kinase activity | |
Molecular Function | phosphotransferase activity, alcohol group as acceptor | |
Molecular Function | ribokinase activity | |
Biological Process | cell division | |
Biological Process | DNA damage response | |
Biological Process | DNA replication initiation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCell cycle regulator CcrZ
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Bacillaceae > Bacillus
Accessions
- Primary accessionC0SPC1
- Secondary accessions
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Cells lacking this gene are slightly thinner and longer, but no anucleate cells are present and they have a growth rate similar to wild-type cells. Significantly decreased DNA replication initiation rate (PubMed:34373624).
Susceptible to a broad range of DNA damage including mitomycin C (MMC), methyl methanesulfonate (MMS), ciprofloxacin, phleomycin and UV irradiation. Significant induction of the DNA damage response (SOS). Not sensitive to kanamycin or gentamicin (PubMed:35576203).
Susceptible to a broad range of DNA damage including mitomycin C (MMC), methyl methanesulfonate (MMS), ciprofloxacin, phleomycin and UV irradiation. Significant induction of the DNA damage response (SOS). Not sensitive to kanamycin or gentamicin (PubMed:35576203).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 21 | No effect on susceptibility to DNA damage. | ||||
Sequence: A → V | ||||||
Mutagenesis | 47 | Loss of ability to complement for the deletion of this protein. | ||||
Sequence: F → A | ||||||
Mutagenesis | 65 | Loss of ability to complement for the deletion of this protein. Loss of native structure. | ||||
Sequence: R → P | ||||||
Mutagenesis | 103 | Able to complement for the deletion of this protein. | ||||
Sequence: S → A | ||||||
Mutagenesis | 112 | Able to complement for the deletion of this protein. | ||||
Sequence: R → A | ||||||
Mutagenesis | 166 | Loss of ATPase activity. Loss of ability to complement for the deletion of this protein. | ||||
Sequence: D → A | ||||||
Mutagenesis | 168 | No effect on activity. | ||||
Sequence: N → A | ||||||
Mutagenesis | 171 | Loss of ability to complement for the deletion of this protein. | ||||
Sequence: N → A | ||||||
Mutagenesis | 184 | Loss of ability to complement for the deletion of this protein. | ||||
Sequence: D → A | ||||||
Mutagenesis | 240 | No effect on activity. | ||||
Sequence: F → A | ||||||
Mutagenesis | 243 | No effect on activity. | ||||
Sequence: W → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000387940 | 1-269 | Cell cycle regulator CcrZ | |||
Sequence: MNIDMNWLGQLLGSDWEIFPAGGATGDAYYAKHNGQQLFLKRNSSPFLAVLSAEGIVPKLVWTKRMENGDVITAQHWMTGRELKPKDMSGRPVAELLRKIHTSKALLDMLKRLGKEPLNPGALLSQLKQAVFAVQQSSPLIQEGIKYLEEHLHEVHFGEKVVCHCDVNHNNWLLSEDNQLYLIDWDGAMIADPAMDLGPLLYHYVEKPAWESWLSMYGIELTESLRLRMAWYVLSETITFIAWHKAKGNDKEFHDAMEELHILMKRIVD |
Proteomic databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 164-171 | Brenner's motif [HXDhX3N] | ||||
Sequence: HCDVNHNN | ||||||
Motif | 180-203 | APH | ||||
Sequence: LYLIDWDGAMIADPAMDLGPLLYH |
Sequence similarities
Belongs to the aminoglycoside phosphotransferase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length269
- Mass (Da)30,791
- Last updated2022-12-14 v2
- Checksum5D05F5B2B8C0709B
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF008220 EMBL· GenBank· DDBJ | AAC00284.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL009126 EMBL· GenBank· DDBJ | CAB14970.2 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |