C0K3N3 · TXVE_CROAT
- ProteinSnake venom vascular endothelial growth factor toxin cratrin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids144 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Snake venom VEGFs that may contribute to venom dispersion and prey subjugation by inducing vascular permeability and hypotension. This protein induces an increase in capillary permeability after intradermal injection, as well as a drastic hypotensive effect after intravenous injection (By similarity).
The hypotension is mediated by nitric oxide (NO), which is produced by VEGF-activated endothelium NO synthase. Also induces angiogenesis in vitro (By similarity).
Like other crotalid VEGFs, this protein interacts with VEGF receptor-1 (FLT1) with a high affinity, whereas it binds to VEGF receptor-2 (KDR) with a low affinity (By similarity).
The hypotension is mediated by nitric oxide (NO), which is produced by VEGF-activated endothelium NO synthase. Also induces angiogenesis in vitro (By similarity).
Like other crotalid VEGFs, this protein interacts with VEGF receptor-1 (FLT1) with a high affinity, whereas it binds to VEGF receptor-2 (KDR) with a low affinity (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | membrane | |
Molecular Function | chemoattractant activity | |
Molecular Function | growth factor activity | |
Molecular Function | toxin activity | |
Molecular Function | vascular endothelial growth factor receptor 1 binding | |
Biological Process | induction of positive chemotaxis | |
Biological Process | positive regulation of angiogenesis | |
Biological Process | positive regulation of endothelial cell proliferation | |
Biological Process | positive regulation of mast cell chemotaxis | |
Biological Process | positive regulation of protein phosphorylation | |
Biological Process | response to hypoxia | |
Biological Process | sprouting angiogenesis | |
Biological Process | vascular endothelial growth factor receptor signaling pathway | |
Biological Process | vascular endothelial growth factor signaling pathway |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSnake venom vascular endothelial growth factor toxin cratrin
- Short namessvVEGF
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Viperidae > Crotalinae > Crotalus
Accessions
- Primary accessionC0K3N3
Subcellular Location
PTM/Processing
Features
Showing features for signal, modified residue, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MAVYLLAVAILFCIQGWPSGTVQG | ||||||
Modified residue | 25 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Chain | PRO_5000452062 | 25-144 | Snake venom vascular endothelial growth factor toxin cratrin | |||
Sequence: QAMSFMEVYERSVCQTREMLVSILDEYPSEVAHLFRPSCVTVLRCGGCCTDESLTCTATGKRSVGREIMRVDPRKGTSKIEVMQFTEHTECECRPRSTVNNGKRKKNPKEGEPRAKFPLV | ||||||
Disulfide bond | 38↔80 | |||||
Sequence: CQTREMLVSILDEYPSEVAHLFRPSCVTVLRCGGCCTDESLTC | ||||||
Disulfide bond | 63 | Interchain (with C-72) | ||||
Sequence: C | ||||||
Disulfide bond | 69↔115 | |||||
Sequence: CGGCCTDESLTCTATGKRSVGREIMRVDPRKGTSKIEVMQFTEHTEC | ||||||
Disulfide bond | 72 | Interchain (with C-63) | ||||
Sequence: C | ||||||
Disulfide bond | 73↔117 | |||||
Sequence: CTDESLTCTATGKRSVGREIMRVDPRKGTSKIEVMQFTEHTECEC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Interaction
Subunit
Homodimer; disulfide-linked. Interacts with VEGF receptor-1 (FLT1) with a high affinity, whereas it binds to VEGF receptor-2 (KDR) with a low affinity. Does not bind VEGF receptor-3 (FLT4).
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 119-137 | Basic and acidic residues | ||||
Sequence: PRSTVNNGKRKKNPKEGEP | ||||||
Region | 119-144 | Disordered | ||||
Sequence: PRSTVNNGKRKKNPKEGEPRAKFPLV |
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. Snake venom VEGF subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length144
- Mass (Da)16,126
- Last updated2009-05-05 v1
- Checksum49F5197653C92A6E
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 119-137 | Basic and acidic residues | ||||
Sequence: PRSTVNNGKRKKNPKEGEP |