C0H859 · NCBP2_SALSA
- ProteinNuclear cap-binding protein subunit 2
- Genencbp2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids155 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC), promoting the interaction between upf1 and upf2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with srrt/ars2, thereby being required for miRNA-mediated RNA interference. The CBC complex also acts as a negative regulator of parn, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, ncbp2/cbp20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires ncbp1/cbp80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure. The conventional cap-binding complex with NCBP2 binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus (By similarity).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 19 | mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 42 | mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 111-115 | mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: RTDWD | ||||||
Binding site | 122-126 | mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: RQYGR | ||||||
Binding site | 132-133 | mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: QV |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nuclear cap binding complex | |
Cellular Component | nucleus | |
Molecular Function | mRNA binding | |
Molecular Function | RNA 7-methylguanosine cap binding | |
Molecular Function | snRNA binding | |
Biological Process | mRNA cis splicing, via spliceosome | |
Biological Process | mRNA transport | |
Biological Process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | |
Biological Process | positive regulation of RNA export from nucleus | |
Biological Process | regulation of translation | |
Biological Process | regulatory ncRNA-mediated gene silencing | |
Biological Process | RNA splicing | |
Biological Process | snRNA export from nucleus |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNuclear cap-binding protein subunit 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Protacanthopterygii > Salmoniformes > Salmonidae > Salmoninae > Salmo
Accessions
- Primary accessionC0H859
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000385253 | 1-155 | Nuclear cap-binding protein subunit 2 | |||
Sequence: MSSKLNALFSDSYVDVSQYRDQHFKGNRYEQEKLLKQANTLYVGNLSFYTTEEQVYELFSKSGDVKRIIIGLDKVKKTACGFCFVEYYTRTDAENAMRFVNGTRLDDRIIRTDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKVVSRP |
Proteomic databases
Interaction
Subunit
Component of the nuclear cap-binding complex (CBC), a heterodimer composed of ncbp1/cbp80 and ncbp2/cbp20 that interacts with m7GpppG-capped RNA.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 39-117 | RRM | ||||
Sequence: NTLYVGNLSFYTTEEQVYELFSKSGDVKRIIIGLDKVKKTACGFCFVEYYTRTDAENAMRFVNGTRLDDRIIRTDWDAG | ||||||
Region | 122-155 | Disordered | ||||
Sequence: RQYGRGKSGGQVRDEYRQDYDPARGGYGKVVSRP | ||||||
Compositional bias | 129-143 | Basic and acidic residues | ||||
Sequence: SGGQVRDEYRQDYDP |
Sequence similarities
Belongs to the RRM NCBP2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length155
- Mass (Da)17,940
- Last updated2009-05-05 v1
- Checksum37E447A35C516D7B
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1S3KKA6 | A0A1S3KKA6_SALSA | ncbp2 | 155 |
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 3 | in Ref. 1; ACH70847 | ||||
Sequence: S → I | ||||||
Compositional bias | 129-143 | Basic and acidic residues | ||||
Sequence: SGGQVRDEYRQDYDP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BT043732 EMBL· GenBank· DDBJ | ACH70847.1 EMBL· GenBank· DDBJ | mRNA | ||
BT058515 EMBL· GenBank· DDBJ | ACN10228.1 EMBL· GenBank· DDBJ | mRNA | ||
BT060223 EMBL· GenBank· DDBJ | ACN12583.1 EMBL· GenBank· DDBJ | mRNA |