B9XXL6 · RHPA_HELP8
- ProteinDEAD-box ATP-dependent RNA helicase RhpA
- GenerhpA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids492 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
DEAD-box RNA helicase probably involved in RNA degradation. Unwinds dsRNA in both 5'- and 3'-directions (By similarity).
Background RNA-dependent ATPase activity is stimulated about 5-fold by RNaseJ (rnj). Stimulates the dsRNase activity of RNase J
Background RNA-dependent ATPase activity is stimulated about 5-fold by RNaseJ (rnj). Stimulates the dsRNase activity of RNase J
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | RNA binding | |
Molecular Function | RNA helicase activity | |
Biological Process | ribosomal large subunit assembly |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDEAD-box ATP-dependent RNA helicase RhpA
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Campylobacterota > Epsilonproteobacteria > Campylobacterales > Helicobacteraceae > Helicobacter
Accessions
- Primary accessionB9XXL6
Subcellular Location
UniProt Annotation
GO Annotation
Note: The RNaseJ-RhpA complex co-localizes with 70S ribosomes and polysomes; remains associated with ribosomes in the absence of RNase J.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Not essential, it can be deleted. RNase J remains associated with the ribosomes and polysomes.
Miscellaneous
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000430106 | 1-492 | DEAD-box ATP-dependent RNA helicase RhpA | |||
Sequence: MELNQPPLPTEIDDDAYHKPSFNDLGLKESVLKSVYEAGFTSPSPIQEKAIPAVLQGRDVIAQAQTGTGKTAAFALPIINNLKNNHTIEALVITPTRELAMQISDEIFKLGKHTRTKTVCVYGGQSVKKQCEFIKKNPQVMIATPGRLLDHLKNERIHKFVPKVVVLDESDEMLDMGFLDDIEEIFDYLPSEAQILLFSATMPEPIKRLADKILENPIKIHIAPSNITNTDITQRFYVINEHERAEAIMRLLDTQAPKKSIVFTRTKKEADELHQFLASKNYKSTALHGDMDQRDRRASIMAFKKNDADVLVATDVASRGLDISGVSHVFNYHLPLNTESYIHRIGRTGRAGKKGMAITLVTPLEYKELLRMQKEIDSEIELFEIPTINENQIIKTLHDAKVSEGIISLYEQLTEIFEPSQLVLKLLSLQFETSKIGLNQQEIDAIQNPKEKTPKPSHKKTPQHERARSFKKGQHRDRHPKTNHHSKKPKRR |
Interaction
Subunit
Homodimer (By similarity).
Interacts with RNase J (rnj), might be a member of a minimal RNA degradosome complex
Interacts with RNase J (rnj), might be a member of a minimal RNA degradosome complex
Structure
Family & Domains
Features
Showing features for motif, domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 20-48 | Q motif | ||||
Sequence: PSFNDLGLKESVLKSVYEAGFTSPSPIQE | ||||||
Domain | 51-220 | Helicase ATP-binding | ||||
Sequence: IPAVLQGRDVIAQAQTGTGKTAAFALPIINNLKNNHTIEALVITPTRELAMQISDEIFKLGKHTRTKTVCVYGGQSVKKQCEFIKKNPQVMIATPGRLLDHLKNERIHKFVPKVVVLDESDEMLDMGFLDDIEEIFDYLPSEAQILLFSATMPEPIKRLADKILENPIKI | ||||||
Motif | 168-171 | DEAD box | ||||
Sequence: DESD | ||||||
Domain | 231-393 | Helicase C-terminal | ||||
Sequence: DITQRFYVINEHERAEAIMRLLDTQAPKKSIVFTRTKKEADELHQFLASKNYKSTALHGDMDQRDRRASIMAFKKNDADVLVATDVASRGLDISGVSHVFNYHLPLNTESYIHRIGRTGRAGKKGMAITLVTPLEYKELLRMQKEIDSEIELFEIPTINENQI | ||||||
Region | 445-492 | Disordered | ||||
Sequence: AIQNPKEKTPKPSHKKTPQHERARSFKKGQHRDRHPKTNHHSKKPKRR | ||||||
Compositional bias | 461-492 | Basic residues | ||||
Sequence: TPQHERARSFKKGQHRDRHPKTNHHSKKPKRR |
Sequence similarities
Belongs to the DEAD box helicase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length492
- Mass (Da)55,845
- Last updated2009-04-14 v1
- Checksum0EA636F0110D3183
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 461-492 | Basic residues | ||||
Sequence: TPQHERARSFKKGQHRDRHPKTNHHSKKPKRR |