B9FKJ7 · B9FKJ7_ORYSJ
- ProteinOs05g0511050 protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids432 (go to sequence)
- Protein existenceInferred from homology
- Annotation score1/5
Function
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 43 | |||||
Sequence: D | ||||||
Active site | 285 | |||||
Sequence: D |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | aspartic-type endopeptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionB9FKJ7
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Disulfide bond | 331↔376 | |||||
Sequence: CTHTPCTQDELPLINFHFLGDVKLTLPKDSCYYAVTAPKNSVVVKC |
Keywords
- PTM
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 25-424 | Peptidase A1 | ||||
Sequence: YLLSLNLGMPPQVFQVYLDTGSDLTWVPCGTNSSYQCLECGNEHSTSKPIPSFSPSQSSSNMKELCGSRFCVDIHSSDNSHDPCAAVGCAIPSFMSDLCTRPCPPFSYTYGGGALVLGSLAKDIVTLHGSIFGIAILLDVPGFCFGCVGSSIREPIGIAGFGKGILSLPSQLGFLDKGFSHCFLGFRFARNPNFTSSLIMGDLALSAKDDFLFTPMLKSITNPNFYYIGLEGVSIGDGAAIAAPPSLSSIDSEGNGGMIVDTGTTYTHLPDPFYTAILSSLASVILYERSYDLEMRTGFDLCFKIPCTHTPCTQDELPLINFHFLGDVKLTLPKDSCYYAVTAPKNSVVVKCLLFQRMDNDDDDDDVGGANNGPGAVLGSFQMQNVEVVYDMEAGRIGFQ |
Sequence similarities
Belongs to the peptidase A1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length432
- Mass (Da)46,482
- Last updated2009-03-24 v1
- Checksum6AD17E296F4A6EF1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP014961 EMBL· GenBank· DDBJ | BAS94841.1 EMBL· GenBank· DDBJ | Genomic DNA |