B8QHP7 · B8QHP7_SHEEP

  • Protein
    Early growth response protein
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Evidence at transcript level
  • Annotation score
    5/5

Function

function

Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentchromatin
Cellular Componentcytoplasm
Cellular Componentnucleoplasm
Cellular Componentnucleus
Molecular FunctionDNA-binding transcription activator activity, RNA polymerase II-specific
Molecular Functiondouble-stranded methylated DNA binding
Molecular Functionhemi-methylated DNA-binding
Molecular Functionhistone acetyltransferase binding
Molecular Functionpromoter-specific chromatin binding
Molecular FunctionRNA polymerase II cis-regulatory region sequence-specific DNA binding
Molecular Functionzinc ion binding
Biological ProcessBMP signaling pathway
Biological Processcellular response to gamma radiation
Biological Processcellular response to heparin
Biological Processcellular response to interleukin-8
Biological Processcellular response to mycophenolic acid
Biological Processcircadian regulation of gene expression
Biological Processcircadian temperature homeostasis
Biological Processestrous cycle
Biological Processglomerular mesangial cell proliferation
Biological Processinterleukin-1-mediated signaling pathway
Biological Processlocomotor rhythm
Biological Processnegative regulation of canonical Wnt signaling pathway
Biological Processnegative regulation of transcription by RNA polymerase II
Biological Processpositive regulation of chemokine production
Biological Processpositive regulation of gene expression via chromosomal CpG island demethylation
Biological Processpositive regulation of glomerular metanephric mesangial cell proliferation
Biological Processpositive regulation of hormone biosynthetic process
Biological Processpositive regulation of interleukin-1 beta production
Biological Processpositive regulation of miRNA transcription
Biological Processpositive regulation of post-translational protein modification
Biological Processregulation of apoptotic process
Biological Processregulation of progesterone biosynthetic process
Biological Processregulation of protein sumoylation
Biological Processresponse to glucose
Biological Processresponse to hypoxia
Biological Processresponse to insulin
Biological Processresponse to ischemia
Biological Processskeletal muscle cell differentiation
Biological ProcessT cell differentiation

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Early growth response protein

Organism names

  • Taxonomic identifier
  • Organism
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Caprinae > Ovis

Accessions

  • Primary accession
    B8QHP7
  • Secondary accessions
    • A0A6P9FQH1

Subcellular Location

Keywords

  • Cellular component

Structure

Family & Domains

Sequence similarities

Belongs to the EGR C2H2-type zinc-finger protein family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    543
  • Mass (Da)
    57,513
  • Last updated
    2009-03-03 v1
  • Checksum
    4FD4C2FC941F7D70
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGASEGSSGSSSSSSSGGGGGGGGGSSSSNSNSSSAFNPQGEASEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSASSPAASSSASQSPPLSCAVQSNDSSPIYSAAPTFPTPNTDIFPEPQGQAFPGSAGPALQYPPPAYPGAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGVESRTQQPSLTPLSTIKAFATQSGSQDLKALNSTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSAASAATSSLPSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSYSSPGSSTYPSPVHNGFPSPSVATTYSSVPPAFPTQVSSFPSSAVTNSFSASTGLSDMTTTFSPRTIEIC

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
EU552504
EMBL· GenBank· DDBJ
ACD74786.1
EMBL· GenBank· DDBJ
mRNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp