B8A2L5 · B8A2L5_MAIZE
- ProteinCryptochrome2
- Gene100194126
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids688 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Cofactor
Note: Binds 1 FAD per subunit.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 226 | FAD (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 238-242 | FAD (UniProtKB | ChEBI) | ||||
Sequence: TSLLS | ||||||
Binding site | 281 | FAD (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Site | 315 | Electron transfer via tryptophanyl radical | ||||
Sequence: W | ||||||
Site | 368 | Electron transfer via tryptophanyl radical | ||||
Sequence: W | ||||||
Binding site | 381-383 | FAD (UniProtKB | ChEBI) | ||||
Sequence: DAD | ||||||
Site | 391 | Electron transfer via tryptophanyl radical | ||||
Sequence: W |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | blue light photoreceptor activity | |
Molecular Function | deoxyribodipyrimidine photo-lyase activity | |
Molecular Function | DNA binding | |
Molecular Function | FAD binding | |
Biological Process | circadian regulation of gene expression | |
Biological Process | entrainment of circadian clock by photoperiod | |
Biological Process | nucleobase-containing compound metabolic process | |
Biological Process | response to stress |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > PACMAD clade > Panicoideae > Andropogonodae > Andropogoneae > Tripsacinae > Zea
Accessions
- Primary accessionB8A2L5
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-132 | Photolyase/cryptochrome alpha/beta | ||||
Sequence: MRIVVWFRRDLRVEDNPALAAAARAGGEVVPAYVWSPEEEGPYYPGRVSRWWISQSLNHLDASLRRLGAGKLVTRRSADAAVALLQLVRDTGATHVYFNHLYDPISLVRDRRLKEMLAAEGIVVQSFNSDLL | ||||||
Region | 593-614 | Disordered | ||||
Sequence: APPAARRTNNGARQHDVFQQRR | ||||||
Region | 644-688 | Disordered | ||||
Sequence: WSPPAASGHSDAFAADEADVSSRSYLGRHPQSHRLMNWSQLSQSS | ||||||
Compositional bias | 668-688 | Polar residues | ||||
Sequence: YLGRHPQSHRLMNWSQLSQSS |
Sequence similarities
Belongs to the DNA photolyase class-1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length688
- Mass (Da)77,628
- Last updated2009-03-03 v1
- Checksum91BEDCE8F9B4B78D
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A804MFC3 | A0A804MFC3_MAIZE | 100194126 | 623 | ||
A0A804MFC6 | A0A804MFC6_MAIZE | 100194126 | 694 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 668-688 | Polar residues | ||||
Sequence: YLGRHPQSHRLMNWSQLSQSS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BT055807 EMBL· GenBank· DDBJ | ACL54414.1 EMBL· GenBank· DDBJ | mRNA | ||
CM007648 EMBL· GenBank· DDBJ | ONM17014.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM007648 EMBL· GenBank· DDBJ | ONM17015.1 EMBL· GenBank· DDBJ | Genomic DNA |