B7ZSG3 · WT1A_XENLA
- ProteinWilms tumor protein homolog A
- Genewt1-a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids414 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Transcription factor required for development of the vascular component of the pronephric kidney, the glomus; may repress tubule-specific gene expression in the portion of the pronephros fated to form the glomus. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3' (By similarity).
Inhibits Wnt-signaling during embryonic development. Function may be isoform-specific: the isoform containing the KTS motif is less effective in inhibiting wnt signaling.
Inhibits Wnt-signaling during embryonic development. Function may be isoform-specific: the isoform containing the KTS motif is less effective in inhibiting wnt signaling.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 389 | Important for interaction with target DNA | ||||
Sequence: K | ||||||
Site | 395 | Important for interaction with target DNA | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nuclear speck | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | double-stranded methylated DNA binding | |
Molecular Function | hemi-methylated DNA-binding | |
Molecular Function | RNA binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | glomus development | |
Biological Process | kidney vasculature development | |
Biological Process | negative regulation of pronephric nephron tubule development | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | negative regulation of Wnt signaling pathway | |
Biological Process | pronephros development | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | specification of pronephric proximal tubule identity | |
Biological Process | Wnt signaling pathway |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameWilms tumor protein homolog A
- Short namesXWT1a ; xWT1
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionB7ZSG3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Shuttles between nucleus and cytoplasm.
Keywords
- Cellular component
Phenotypes & Variants
Keywords
- Disease
PTM/Processing
Features
Showing features for chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000391387 | 1-414 | Wilms tumor protein homolog A | |||
Sequence: MGSDVRDMNLLPPVSSLSGNSSCNMPVSSSAQWAPVLDFPPGAPYSSLTPHSFIKQEPTWNPDPHEDQCLSAFTVHFSGQFTGTAGACRYGPFGAPTPSQATTGQARMFSNAPYLSNCLDNQQGMRNQGYSAVAFDGTPSYGHTPSHHTSQFTNHSFKHEDPLSQQTSLGEQQYSVPPPVYGCHTPTDTCTGSQALLLRTPYNSDNLYPMTSQLDCMTWNQMNLGSSLKSHGTSYENDSHSSPMLYNCGGQYRIHTHGVFRGIQDVRRVPGVTPAIVRSTEANEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGIKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL | ||||||
Cross-link | 55 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K | ||||||
Cross-link | 158 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) | ||||
Sequence: K |
Keywords
- PTM
Expression
Tissue specificity
Expressed around the pronephric anlage and in the pronephros; expression is restricted to the splanchnic mesoderm (the site where the glomus forms) from tailbud stages, and the glomus of early tadpoles. Not expressed in the pronephric tubules or pronephric duct. In tadpoles (stage 38-39), additional expression begins in the heart. Also expressed in the adult kidney (mesonephros).
Induction
By retinoic acid in combination with fgf. By lmx1b in combination with lhx1/lim1.
Developmental stage
Expression begins around stage 18 (late neurula).
Gene expression databases
Structure
Family & Domains
Features
Showing features for motif, zinc finger, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 217-225 | 9aaTAD | ||||
Sequence: MTWNQMNLG | ||||||
Zinc finger | 288-312 | C2H2-type 1 | ||||
Sequence: FMCAYPGCNKRYFKLSHLQMHSRKH | ||||||
Zinc finger | 318-342 | C2H2-type 2 | ||||
Sequence: YQCDFKDCERRFSRSDQLKRHQRRH | ||||||
Region | 332-346 | Important for interaction with target DNA | ||||
Sequence: SDQLKRHQRRHTGIK | ||||||
Zinc finger | 348-370 | C2H2-type 3 | ||||
Sequence: FQCKTCQRKFSRSDHLKTHTRTH | ||||||
Region | 358-366 | Important for interaction with target DNA | ||||
Sequence: SRSDHLKTH | ||||||
Motif | 373-375 | KTS motif | ||||
Sequence: KTS | ||||||
Zinc finger | 379-403 | C2H2-type 4 | ||||
Sequence: FSCRWPSCQKKFARSDELVRHHNMH |
Domain
Binds to DNA motifs with the sequence 5'-GCG(T/G)GGGCG-3' via its C2H2-type zinc fingers. Starting from the N-terminus, the second zinc finger binds to the 3'-GCG motif, the middle zinc finger interacts with the central TGG motif, and the C-terminal zinc finger binds to the 5'-GCG motif. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Has reduced affinity for target DNA where the cytosines have been oxidized to 5-hydroxymethylcytosine, 5-formylcytosine or 5-carboxylcytosine.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
Sequence similarities
Belongs to the EGR C2H2-type zinc-finger protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
B7ZSG3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length414
- Mass (Da)46,660
- Last updated2009-03-03 v1
- ChecksumE9B3A657961F7BE1
B7ZSG3-2
- Name2
- Differences from canonical
- 373-375: Missing
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 147 | in Ref. 1; AAB53152 | ||||
Sequence: Missing | ||||||
Alternative sequence | VSP_038721 | 373-375 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U42011 EMBL· GenBank· DDBJ | AAB53152.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BC170513 EMBL· GenBank· DDBJ | AAI70513.1 EMBL· GenBank· DDBJ | mRNA | ||
X85733 EMBL· GenBank· DDBJ | CAA59738.1 EMBL· GenBank· DDBJ | mRNA |