B6VQA1 · DIMM_DROME
- ProteinProtein dimmed
- Genedimm
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids390 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor that regulates neurosecretory (NS) cell function and neuroendocrine cell fate. Acts as a master regulator of common NS functions such as Phm expression and neuropeptide production. Plays a role as a regulator of peptide-containing large dense-core vesicle (LDCV) production and peptidergic cell differentiation. Controls transcription of FMRFamide in Tv neuronal cells and Fur1 in Ap-let cells (Tvb and dorsal apterous cells). Also required for up-regulation of Phm in Tv and Ap-let cells, and expression of three neuropeptide genes, Ms, FMRFamide and Lk. Influences both regulated and constitutive secretory activity in neuroendocrine cells at embryonic and postembryonic level. Loss of function studies show reduced cellular levels of various neuropeptides and neuropeptide biosynthetic enzymes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | E-box binding | |
Molecular Function | protein dimerization activity | |
Biological Process | axon development | |
Biological Process | neuroendocrine cell differentiation | |
Biological Process | neuron fate commitment | |
Biological Process | positive regulation of hormone secretion | |
Biological Process | positive regulation of peptide secretion | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | sensory organ development | |
Biological Process | ventral cord development |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein dimmed
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionB6VQA1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 164-166 | Reduced DNA-binding activity. | ||||
Sequence: RER → GGG |
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000412993 | 1-390 | Protein dimmed | |||
Sequence: MDATQLTELMGSHDFMQLQHQLHHNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVGGVLLSNLSSESGGPVASGIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATVTTSPAMQSIQSQAIHLQTPMEQQQQQASHLPHHQQAMHGHGHLGASIQSQQQPSLVLNGTTSVGLGIGIGVGVGVGVGVCNNAPSFADINDNFDEPFREFL | ||||||
Glycosylation | 61 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 128 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 133 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 140 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 207 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 237 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 347 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in the developing nervous system in the bilateral domains in the cephalic region that later on forms part of the ring gland. Concomitantly expressed in the larval central nervous system (CNS), including the dorsal chain neurons as well as several bilateral clusters of neurons: large, midline protocerebral brain cells (MC), lateral protocerebral brain cells (LC), ventral subesophageal neurons (SE) and lateral abdominal neurons, and the transverse nerves. Outside the CNS, detected in at least three classes of endocrine cells: intrinsic cells of the corpora cardiaca, midgut cells, the Inka cells, lateral Bipolar neurons associated with the segmental transverse nerve, and several peptidergic cells of the enteric nervous system. Expressed only in central and peripheral neuroendocrine secretory cells and neurosecretory neurons but not in sensory or motor neurons.
Developmental stage
First detected in the embryonic ectoderm at early stage 11, but this expression is transient. Zygotic expression is first detected in stage 12 embryos and cytoplasmic expression is detected in many cells around stage 14. Embryonic cells maintain expression throughout their lifetime and expression continues into hatchling larvae less than 24 hours old.
Gene expression databases
Interaction
Subunit
Forms homodimers via the bHLH domain. These dimers bind the core E-box sequence.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | B6VQA1 | disco P23792 | 3 | EBI-166061, EBI-152064 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 24-101 | Polar residues | ||||
Sequence: HNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCS | ||||||
Region | 24-163 | Disordered | ||||
Sequence: HNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPSGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNMRRLESNE | ||||||
Compositional bias | 108-143 | Polar residues | ||||
Sequence: SGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASR | ||||||
Compositional bias | 146-163 | Basic and acidic residues | ||||
Sequence: KGALNAKERNMRRLESNE | ||||||
Domain | 156-208 | bHLH | ||||
Sequence: MRRLESNERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINL | ||||||
Region | 312-339 | Disordered | ||||
Sequence: QQQQASHLPHHQQAMHGHGHLGASIQSQ |
Domain
The basic domain binds to the canonical E-box (5'-CANNTG-3'), with a particular preference for TA relative to AT or CG in the variable central nucleotide positions.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length390
- Mass (Da)40,980
- Last updated2008-12-16 v1
- ChecksumC877F99770EDDCF8
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M9PDD7 | M9PDD7_DROME | dimm | 390 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 24-101 | Polar residues | ||||
Sequence: HNNNNYNTDGHNGLSSESAEGSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCS | ||||||
Compositional bias | 108-143 | Polar residues | ||||
Sequence: SGRGRVQQASSGACPSTIAPNSTSSNSSNANGNASR | ||||||
Compositional bias | 146-163 | Basic and acidic residues | ||||
Sequence: KGALNAKERNMRRLESNE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014134 EMBL· GenBank· DDBJ | AAF53991.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT028819 EMBL· GenBank· DDBJ | ABI34200.4 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BT028851 EMBL· GenBank· DDBJ | ABI34232.3 EMBL· GenBank· DDBJ | mRNA | Different initiation |