B5XYE2 · NUDC_KLEP3
- ProteinNAD-capped RNA hydrolase NudC
- GenenudC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids257 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA. The NAD-cap is present at the 5'-end of some mRNAs and stabilizes RNA against 5'-processing. Has preference for mRNAs with a 5'-end purine. Catalyzes the hydrolysis of a broad range of dinucleotide pyrophosphates.
Catalytic activity
- a 5'-end NAD+-phospho-ribonucleoside in mRNA + H2O = a 5'-end phospho-adenosine-phospho-ribonucleoside in mRNA + beta-nicotinamide D-ribonucleotide + 2 H+This reaction proceeds in the forward direction.
Cofactor
Protein has several cofactor binding sites:
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
Note: Divalent metal cations. Mg2+ or Mn2+.
Note: Binds 1 zinc ion per subunit.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 69 | substrate | ||||
Sequence: R | ||||||
Binding site | 98 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 101 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 111 | substrate | ||||
Sequence: E | ||||||
Binding site | 116 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 119 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 124 | substrate | ||||
Sequence: Y | ||||||
Binding site | 158 | a divalent metal cation 1 (UniProtKB | ChEBI) | ||||
Sequence: A | ||||||
Binding site | 174 | a divalent metal cation 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 174 | a divalent metal cation 3 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 178 | a divalent metal cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 178 | a divalent metal cation 3 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 192-199 | substrate | ||||
Sequence: QPWPFPQS | ||||||
Binding site | 219 | a divalent metal cation 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 219 | a divalent metal cation 3 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 241 | substrate | ||||
Sequence: A |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | magnesium ion binding | |
Molecular Function | manganese ion binding | |
Molecular Function | NAD+ diphosphatase activity | |
Molecular Function | NADH pyrophosphatase activity | |
Molecular Function | RNA NAD-cap (NMN-forming) hydrolase activity | |
Molecular Function | zinc ion binding | |
Biological Process | NAD catabolic process | |
Biological Process | NADH metabolic process | |
Biological Process | NADP catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNAD-capped RNA hydrolase NudC
- EC number
- Short namesDeNADding enzyme NudC
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Klebsiella/Raoultella group > Klebsiella
Accessions
- Primary accessionB5XYE2
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_1000115244 | 1-257 | NAD-capped RNA hydrolase NudC | |||
Sequence: MDRIIEKLDRGWWVVSHEQKLWLPGGELPHGEAVNFDLVGQHALHIGEWQGESVWMVRQDRRHDMGSLRQVLDQDPGLFQLAGRGIQLAEFYRSHKFCGYCGHPMHASKSEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMADYADGDIVVDKKELLTADWYRYDNLPLLPPPGTVARRLIEDTVAMCRAEFE |
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 125-248 | Nudix hydrolase | ||||
Sequence: PQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMADYADGDIVVDKKELLTADWYRYDNLPLLPPPGTVARRLIEDT | ||||||
Motif | 159-180 | Nudix box | ||||
Sequence: GFVEVGETLEQAVAREVMEESG |
Sequence similarities
Belongs to the Nudix hydrolase family. NudC subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length257
- Mass (Da)29,522
- Last updated2008-11-25 v1
- ChecksumAA9EBF71D5DEC43C
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP000964 EMBL· GenBank· DDBJ | ACI07309.1 EMBL· GenBank· DDBJ | Genomic DNA |