B5X4Z9 · STU_ARATH
- ProteinProtein kinase STUNTED
- GeneSTU
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids617 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Promotes cell proliferation in the gibberellic acid (GA) signaling pathway, acting downstream of RGA, and possibly through a negative regulation of two cyclin-dependent kinase inhibitors SIM and SMR1.
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | ATP binding | |
Molecular Function | hydrolase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | gibberellic acid mediated signaling pathway | |
Biological Process | gibberellin mediated signaling pathway | |
Biological Process | positive regulation of cell division | |
Biological Process | response to gibberellin |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein kinase STUNTED
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionB5X4Z9
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
General retarded growth with small curled leaves and short roots in seedlings, as well as delayed floral transition and lower fertility; these phenotypes are partly due to a reduced cell proliferation.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 81 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000454232 | 1-617 | Protein kinase STUNTED | |||
Sequence: MAVDKVIVKQRNIILVGIPIDESGVEVLKWALEEVAKHGDCVVVVHVCFTYYRALKSKSSLDRYLKPYIEFCSTKKIELKGEVLKGNSVLGVLVKEAKRYNAMSVVVGVKQQSKLSLKIAKGCAKELPSTTDILAIHRGNIVFRRSNHYQLPLAQKISSRPSSELSEGFSDKDLAKTTGQEKRKISGRSLSLPSVEVVDQTPGWPLLRTSTLATPMVQHQTRKISVVNWVMSLPERFPHHPNQTCQQSFCDKQLKDILKDINRWFSYDVLKTATSDFSLENLIGKGGCNEVYKGFLEDGKGVAVKILKPSVKEAVKEFVHEVSIVSSLSHSNISPLIGVCVHYNDLISVYNLSSKGSLEETLQGKHVLRWEERLKIAIGLGEALDYLHNQCSNPVIHRDVKSSNVLLSDEFEPQLSDFGLSMWGSKSCRYTIQRDVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTSISSDSPRGQESLVMWAKPMIEKGNAKELLDPNIAGTFDEDQFHKMVLAATHCLTRAATYRPNIKEILKLLRGEDDVSKWVKIEEDDEDGFDDEVYPNSNTELHLSLAMVDVEDNDSVSNSSLERSNNSLFSSSSSSSQELQS | ||||||
Modified residue | 350 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 403 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 439 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 447 | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed ubiquitously, mostly in roots, to a lower extent in leaves, floral buds and stems, and, at low levels, in flowers and siliques.
Induction
Induced by gibberellins (GA) in seedlings shoot apices, in tissues containing actively dividing cells (PubMed:22492352).
Down-regulated by RGA in the GA signaling pathway (PubMed:22492352).
Down-regulated by RGA in the GA signaling pathway (PubMed:22492352).
Developmental stage
In young seedlings, observed in shoot apices and roots and accumulates gradually in the leaf vasculature (PubMed:22492352).
Later expressed in inflorescence apices, especially in the center, and in secondary inflorescence meristems (PubMed:22492352).
In floral buds and flowers, strongly present in anthers (specifically in the tapetum), ovules and pollen (PubMed:22492352).
Later expressed in inflorescence apices, especially in the center, and in secondary inflorescence meristems (PubMed:22492352).
In floral buds and flowers, strongly present in anthers (specifically in the tapetum), ovules and pollen (PubMed:22492352).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 162-187 | Disordered | ||||
Sequence: SSELSEGFSDKDLAKTTGQEKRKISG | ||||||
Compositional bias | 166-183 | Basic and acidic residues | ||||
Sequence: SEGFSDKDLAKTTGQEKR | ||||||
Domain | 277-555 | Protein kinase | ||||
Sequence: FSLENLIGKGGCNEVYKGFLEDGKGVAVKILKPSVKEAVKEFVHEVSIVSSLSHSNISPLIGVCVHYNDLISVYNLSSKGSLEETLQGKHVLRWEERLKIAIGLGEALDYLHNQCSNPVIHRDVKSSNVLLSDEFEPQLSDFGLSMWGSKSCRYTIQRDVVGTFGYLAPEYFMYGKVSDKVDVYAFGVVLLELISGRTSISSDSPRGQESLVMWAKPMIEKGNAKELLDPNIAGTFDEDQFHKMVLAATHCLTRAATYRPNIKEILKLLRGEDDVSKWV | ||||||
Region | 590-617 | Disordered | ||||
Sequence: DSVSNSSLERSNNSLFSSSSSSSQELQS |
Domain
The protein kinase domain is predicted to be catalytically inactive.
Sequence similarities
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
B5X4Z9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length617
- Mass (Da)68,877
- Last updated2008-11-25 v1
- Checksum8DF18CBC98784613
B5X4Z9-2
- Name2
- Differences from canonical
- 1-493: Missing
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_061267 | 1-493 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 166-183 | Basic and acidic residues | ||||
Sequence: SEGFSDKDLAKTTGQEKR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005825 EMBL· GenBank· DDBJ | AAD24608.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002685 EMBL· GenBank· DDBJ | AEC06534.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | ANM61982.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK176289 EMBL· GenBank· DDBJ | BAD44052.1 EMBL· GenBank· DDBJ | mRNA | ||
BT046118 EMBL· GenBank· DDBJ | ACI46506.1 EMBL· GenBank· DDBJ | mRNA |