B5SNS7 · B5SNS7_ADE41
- ProteinDNA-binding protein
- GeneDBP
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids474 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 231 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 233 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 286 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 302 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 343 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 345 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 397 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 413 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell nucleus | |
Cellular Component | viral capsid | |
Molecular Function | DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | DNA unwinding involved in DNA replication | |
Biological Process | DNA-templated transcription | |
Biological Process | positive regulation of DNA replication | |
Biological Process | viral DNA strand displacement replication |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameDNA-binding protein
- Short namesDBP
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Preplasmiviricota > Tectiliviricetes > Rowavirales > Adenoviridae > Mastadenovirus > Human mastadenovirus F
- Virus hosts
Accessions
- Primary accessionB5SNS7
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Accumulates in infected cells.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 142 | Phosphotyrosine; by host | ||||
Sequence: Y |
Keywords
- PTM
Expression
Keywords
- Developmental stage
Interaction
Subunit
Homomultimerizes on viral ssDNA bound to pTP. Forms a initiation complex with viral polymerase, pTP and hosts NFIA and POU2F1/OCT1. Interacts with host SRCAP.
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-34 | Disordered | ||||
Sequence: MAGRQREHPTVTPYLQETSPERPPPLPPKKKLRK | ||||||
Domain | 132-206 | Adenovirus DNA-binding all-alpha | ||||
Sequence: MELMNVLMEKYHVENDEKTAFKFLPEQNAVYRKICQTWLNEERRGLSLTFTTQKTFTELMGRFLAAYVETYAGVK | ||||||
Domain | 229-330 | Adenovirus DNA-binding zinc-binding | ||||
Sequence: LRCFHGREMIQKEQVVEVDVGSENGQRALKEQPSKTKVVQNRWGRSVVQIKNDDARCCAEDVSCGNNMFSSKSCGLFFSEGLKAQIAFKQMQAFLQAEYPQM | ||||||
Region | 244-278 | Flexible loop | ||||
Sequence: VEVDVGSENGQRALKEQPSKTKVVQNRWGRSVVQI | ||||||
Domain | 341-436 | Adenovirus DNA-binding zinc-binding | ||||
Sequence: LRCECLNKKDLVPQLGRQMCKVTPFALSGAEDLKTSEVTDKSALASILHPCVLVFQCANPVYRNSRGSAGPNCDFKISAPDVISALQLVRQFWKEN | ||||||
Region | 460-474 | C-terminal arm, DBP binding | ||||
Sequence: VALPTGHGDAEVEPF |
Domain
The C-terminal arm bridges DBP molecules together, thereby creating a chain.
Sequence similarities
Belongs to the adenoviridae E2A DNA-binding protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length474
- Mass (Da)53,658
- Last updated2008-11-04 v1
- Checksum4350AE593088B19E