B5DG42 · IF4A3_SALSA
- ProteinEukaryotic initiation factor 4A-III
- Geneeif4a3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids406 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
ATP-dependent RNA helicase. Involved in pre-mRNA splicing as component of the spliceosome. Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Binds spliced mRNA in sequence-independent manner, 20-24 nucleotides upstream of mRNA exon-exon junctions (By similarity).
Involved in craniofacial development (By similarity).
Involved in craniofacial development (By similarity).
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 55 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 60 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 77-84 | ATP (UniProtKB | ChEBI) | ||||
Sequence: SQSGTGKT | ||||||
Binding site | 80-85 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GTGKTA | ||||||
Binding site | 337 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 362-366 | ATP (UniProtKB | ChEBI) | ||||
Sequence: RSGRY |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nuclear speck | |
Cellular Component | nucleus | |
Cellular Component | U2-type catalytic step 1 spliceosome | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | RNA binding | |
Molecular Function | RNA helicase activity | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | mRNA transport | |
Biological Process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | |
Biological Process | regulation of alternative mRNA splicing, via spliceosome | |
Biological Process | regulation of translation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEukaryotic initiation factor 4A-III
- EC number
- Short nameseIF-4A-III; eIF4A-III
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Protacanthopterygii > Salmoniformes > Salmonidae > Salmoninae > Salmo
Accessions
- Primary accessionB5DG42
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Nucleocytoplasmic shuttling protein. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000379481 | 1-406 | Eukaryotic initiation factor 4A-III | |||
Sequence: MEVATVPRTRRLLKEEDMTKIEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHSCIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Identified in the spliceosome C complex. Part of the mRNA splicing-dependent exon junction complex (EJC) complex; the core complex contains casc3, eif4a3, magoh and rbm8a.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 33-61 | Q motif | ||||
Sequence: PTFDTMGLREDLLRGIYAYGFEKPSAIQQ | ||||||
Domain | 64-234 | Helicase ATP-binding | ||||
Sequence: IKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQVRETQALILAPTRELAGQIQKVLLALGDYMNVQCHSCIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVCLISATLPHEILEMTNKFMTDPIRI | ||||||
Motif | 182-185 | DEAD box | ||||
Sequence: DEAD | ||||||
Domain | 245-406 | Helicase C-terminal | ||||
Sequence: GIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI |
Sequence similarities
Belongs to the DEAD box helicase family. eIF4A subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length406
- Mass (Da)46,582
- Last updated2008-10-14 v1
- Checksum7E4EC7404C13E31C
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1S2X3J2 | A0A1S2X3J2_SALSA | if4a3 | 406 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BT043601 EMBL· GenBank· DDBJ | ACH70716.1 EMBL· GenBank· DDBJ | mRNA | ||
BT047669 EMBL· GenBank· DDBJ | ACI67470.1 EMBL· GenBank· DDBJ | mRNA |