B5A5T4 · QVR_DROME
- ProteinUPAR/Ly6 domain-containing protein qvr
- Geneqvr
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids158 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Bifunctional regulator of neuronal activity in the mushroom body, and possibly other regions of the brain, that acts as a signaling molecule required for homeostatic regulation of sleep under normal conditions and after sleep deprivation (PubMed:18635795, PubMed:20010822, PubMed:24613312).
Reduces neuronal excitability by enhancing Sh/shaker K+ channel activity; possibly by stabilizing Sh/shaker to increase protein levels, accelerating its activation kinetics, slowing C-type inactivation and enhancing recovery from inactivation (PubMed:10934243, PubMed:18635795, PubMed:20010822, PubMed:20429677, PubMed:21813698, PubMed:24613312).
Specifically affects the A-type K+ current (PubMed:10934243).
Antagonizes nicotinic acetylcholine receptors (nAChRs) to reduce synaptic transmission, possibly by preventing their localization to the cell surface (PubMed:24613312, PubMed:26828958).
Required for regulation of neuromuscular excitability and plasticity at neuromuscular junctions (PubMed:29117754).
Reduces neuronal excitability by enhancing Sh/shaker K+ channel activity; possibly by stabilizing Sh/shaker to increase protein levels, accelerating its activation kinetics, slowing C-type inactivation and enhancing recovery from inactivation (PubMed:10934243, PubMed:18635795, PubMed:20010822, PubMed:20429677, PubMed:21813698, PubMed:24613312).
Specifically affects the A-type K+ current (PubMed:10934243).
Antagonizes nicotinic acetylcholine receptors (nAChRs) to reduce synaptic transmission, possibly by preventing their localization to the cell surface (PubMed:24613312, PubMed:26828958).
Required for regulation of neuromuscular excitability and plasticity at neuromuscular junctions (PubMed:29117754).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Cellular Component | membrane raft | |
Cellular Component | plasma membrane | |
Molecular Function | acetylcholine receptor inhibitor activity | |
Molecular Function | GPI anchor binding | |
Molecular Function | potassium channel activator activity | |
Biological Process | negative regulation of membrane potential | |
Biological Process | positive regulation of circadian sleep/wake cycle, sleep | |
Biological Process | regulation of circadian sleep/wake cycle, sleep | |
Biological Process | regulation of synaptic transmission, cholinergic | |
Biological Process | rhythmic process | |
Biological Process | sleep |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUPAR/Ly6 domain-containing protein qvr
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionB5A5T4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Lipid-anchor, GPI-anchor
Membrane raft ; Lipid-anchor, GPI-anchor
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 33-135 | Extracellular | ||||
Sequence: ECQTRSIYCYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCCVKMVRHQRSPYEVVRRMCTSQLQINLFMVDHVCMMESSGNGHMCFCEEDMCNSSKNLHTN | ||||||
Transmembrane | 136-156 | Helical | ||||
Sequence: GCQLHLIPIAVAVSWLMGQLL | ||||||
Topological domain | 157-158 | Cytoplasmic | ||||
Sequence: SR |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Hypersensitivity to reactive oxygen species generated by the redox-cycling agent paraquat (PubMed:10934243, PubMed:8776866).
Vigorous leg shaking, abdomen pulsation, and body shuddering in adult flies under ether-induced anasthesia (PubMed:29117754, PubMed:8776866).
Both daytime and nighttime sleep are severely reduced in males and females (PubMed:18635795).
A small percentage of flies (around 9%) do not sleep at all (PubMed:18635795).
A moderate reduction has minimal effects on baseline sleep but markedly reduces the amount of recovery sleep after sleep deprivation (PubMed:18635795).
Mutants have impaired Sh-dependent K+ current (PubMed:18635795).
Weakened climbing ability of adult flies (PubMed:29117754).
Neuromuscular hyperexcitability and mild synaptic overgrowth at larval neuromuscular junctions (PubMed:10934243, PubMed:29117754).
Disrupted regulation of the diurnal cycle of germline stem cell replication in males (PubMed:24516136).
Vigorous leg shaking, abdomen pulsation, and body shuddering in adult flies under ether-induced anasthesia (PubMed:29117754, PubMed:8776866).
Both daytime and nighttime sleep are severely reduced in males and females (PubMed:18635795).
A small percentage of flies (around 9%) do not sleep at all (PubMed:18635795).
A moderate reduction has minimal effects on baseline sleep but markedly reduces the amount of recovery sleep after sleep deprivation (PubMed:18635795).
Mutants have impaired Sh-dependent K+ current (PubMed:18635795).
Weakened climbing ability of adult flies (PubMed:29117754).
Neuromuscular hyperexcitability and mild synaptic overgrowth at larval neuromuscular junctions (PubMed:10934243, PubMed:29117754).
Disrupted regulation of the diurnal cycle of germline stem cell replication in males (PubMed:24516136).
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-32 | |||||
Sequence: MWTQRNAVGNWLLVLTAVIGFLTFIWIPQTSA | ||||||
Chain | PRO_0000359760 | 33-127 | UPAR/Ly6 domain-containing protein qvr | |||
Sequence: ECQTRSIYCYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCCVKMVRHQRSPYEVVRRMCTSQLQINLFMVDHVCMMESSGNGHMCFCEEDMCN | ||||||
Disulfide bond | 41↔75 | |||||
Sequence: CYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCC | ||||||
Disulfide bond | 44↔52 | |||||
Sequence: CDSWTDARC | ||||||
Glycosylation | 57 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 71↔93 | |||||
Sequence: CNGCCVKMVRHQRSPYEVVRRMC | ||||||
Disulfide bond | 108↔119 | |||||
Sequence: CMMESSGNGHMC | ||||||
Disulfide bond | 121↔126 | |||||
Sequence: CEEDMC | ||||||
Lipidation | 127 | GPI-anchor amidated asparagine | ||||
Sequence: N | ||||||
Propeptide | PRO_0000459821 | 128-158 | Removed in mature form | |||
Sequence: SSKNLHTNGCQLHLIPIAVAVSWLMGQLLSR |
Post-translational modification
N-glycosylated probably on Asn-57.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in mushroom body (at protein level); overlaps with expression of Sh/shaker and nicotinic acetylcholine receptor (nAChR) components also involved in sleep regulation (PubMed:24613312).
Expressed in the adult brain and head (PubMed:18635795, PubMed:20010822).
Enriched in the mushroom body, anterior optic tubercle, superior protocerebrum, antennal nerve and visual projection neuron fibers projecting into the lobula plate of the optic lobe (PubMed:20010822).
Expressed in the adult brain and head (PubMed:18635795, PubMed:20010822).
Enriched in the mushroom body, anterior optic tubercle, superior protocerebrum, antennal nerve and visual projection neuron fibers projecting into the lobula plate of the optic lobe (PubMed:20010822).
Gene expression databases
Interaction
Subunit
Interacts (via loop 2 of the three-fingered Ly-6 domain) with Sh/shaker; this interaction may stabilize both components of the complex and may be required for targeting or retention of Sh/shaker to neural cell projections (PubMed:20010822, PubMed:24613312, PubMed:26828958).
Interacts (via loop 2 of the three-fingered Ly-6 domain) with nAChRalpha3 and potentially other nicotinic acetylcholine receptors; this interaction is required for antagonism of nicotinic acetylcholine receptors (PubMed:24613312, PubMed:26828958).
Interacts (via loop 2 of the three-fingered Ly-6 domain) with nAChRalpha3 and potentially other nicotinic acetylcholine receptors; this interaction is required for antagonism of nicotinic acetylcholine receptors (PubMed:24613312, PubMed:26828958).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 54-67 | Loop 1; may be required for cell surface localization or be essential for protein folding | ||||
Sequence: DPFNYTALPRDQPP | ||||||
Region | 77-91 | Loop 2; required for interaction with Sh/shaker and nAChRalpha3/Nicotinic acetylcholine receptor alpha3 | ||||
Sequence: KMVRHQRSPYEVVRR |
Domain
Consists of a single Ly-6 domain, adopting a three finger fold stabilized by 5 disulfide bonds (Probable). The first loop contains a region essential for protein folding or that is required for localization to the cell surface (PubMed:26828958).
The second loop mediates protein-protein interactions (PubMed:24613312, PubMed:26828958).
The second loop mediates protein-protein interactions (PubMed:24613312, PubMed:26828958).
Sequence similarities
Belongs to the quiver family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length158
- Mass (Da)18,124
- Last updated2011-09-21 v2
- ChecksumBF3E8327EC40A58F
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4LEU0 | A0A0B4LEU0_DROME | qvr | 155 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 110-117 | in Ref. 1; ACF58241 | ||||
Sequence: MESSGNGH → VEGSGSGR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU816195 EMBL· GenBank· DDBJ | ACF58241.1 EMBL· GenBank· DDBJ | mRNA | ||
AE013599 EMBL· GenBank· DDBJ | ACL83100.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY089495 EMBL· GenBank· DDBJ | AAL90233.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |