B4XT64 · NAL1_ORYSJ
- ProteinProtein NARROW LEAF 1
- GeneNAL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids582 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the regulation of lateral leaf growth (PubMed:18562767, PubMed:22179305, PubMed:23985993).
May be involved in the regulation of basipetal polar auxin transport (PAT) and vascular patterning in leaves (PubMed:18562767).
Controls photosynthesis rate by regulating carboxylation efficiency and consequently photosynthesis rate (PubMed:23985993).
Controls panicle and spikelet numbers, and grain yield (PubMed:23985993, PubMed:24297875, PubMed:24795339).
May be involved in the regulation of basipetal polar auxin transport (PAT) and vascular patterning in leaves (PubMed:18562767).
Controls photosynthesis rate by regulating carboxylation efficiency and consequently photosynthesis rate (PubMed:23985993).
Controls panicle and spikelet numbers, and grain yield (PubMed:23985993, PubMed:24297875, PubMed:24795339).
Biotechnology
Utilization of photosynthesis-related QTLs can enhance high-yield breeding and provide a new strategy for achieving increased rice productivity.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleoplasm | |
Biological Process | internode patterning | |
Biological Process | leaf vascular tissue pattern formation | |
Biological Process | regulation of leaf development | |
Biological Process | stem vascular tissue pattern formation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProtein NARROW LEAF 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionB4XT64
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Expressed in discrete structures which appeared similar to nuclear protein bodies.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Narrow leaf phenotype (PubMed:18562767).
Reduced leaf blade width and plant height (PubMed:18562767).
Altered internode elongation pattern (PubMed:18562767).
Altered vascular patterns in leaves and culms (PubMed:18562767).
Reduced leaf blade width and plant height (PubMed:18562767).
Altered internode elongation pattern (PubMed:18562767).
Altered vascular patterns in leaves and culms (PubMed:18562767).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 233 | Reduced grain yield; when associated with A-475 and V-484. | ||||
Sequence: H → R | ||||||
Mutagenesis | 475 | Reduced grain yield; when associated with R-233 and V-484. | ||||
Sequence: V → A | ||||||
Mutagenesis | 484 | Reduced grain yield; when associated with R-233 and A-475. | ||||
Sequence: I → V |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000445264 | 1-582 | Protein NARROW LEAF 1 | |||
Sequence: MKPSDDKAQLSGLAQSEESSLDVDHQSFPCSPSIQPVASGCTHTENSAAYFLWPTSNLQHCAAEGRANYFGNLQKGLLPRHPGRLPKGQQANSLLDLMTIRAFHSKILRRFSLGTAVGFRIRKGDLTDIPAILVFVARKVHKKWLNPAQCLPAILEGPGGVWCDVDVVEFSYYGAPAQTPKEQMFSELVDKLCGSDECIGSGSQVASHETFGTLGAIVKRRTGNKQVGFLTNHHVAVDLDYPNQKMFHPLPPNLGPGVYLGAVERATSFITDDVWYGIYAGTNPETFVRADGAFIPFADDFDISTVTTVVRGVGDIGDVKVIDLQCPLNSLIGRQVCKVGRSSGHTTGTVMAYALEYNDEKGICFFTDILVVGENRQTFDLEGDSGSLIILTSQDGEKPRPIGIIWGGTANRGRLKLTSDHGPENWTSGVDLGRLLDRLELDIIITNESLQDAVQQQRFALVAAVTSAVGESSGVPVAIPEEKIEEIFEPLGIQIQQLPRHDVAASGTEGEEASNTVVNVEEHQFISNFVGMSPVRDDQDAPRSITNLNNPSEEELAMSLHLGDREPKRLRSDSGSSLDLEK |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Disordered | ||||
Sequence: MKPSDDKAQLSGLAQSEESSLDVDHQ | ||||||
Compositional bias | 9-26 | Polar residues | ||||
Sequence: QLSGLAQSEESSLDVDHQ | ||||||
Region | 531-582 | Disordered | ||||
Sequence: GMSPVRDDQDAPRSITNLNNPSEEELAMSLHLGDREPKRLRSDSGSSLDLEK | ||||||
Compositional bias | 540-554 | Polar residues | ||||
Sequence: DAPRSITNLNNPSEE | ||||||
Compositional bias | 558-582 | Basic and acidic residues | ||||
Sequence: MSLHLGDREPKRLRSDSGSSLDLEK | ||||||
Motif | 567-573 | Nuclear localization signal | ||||
Sequence: PKRLRSD |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length582
- Mass (Da)63,252
- Last updated2008-09-23 v1
- Checksum25CF326B53D58185
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 9-26 | Polar residues | ||||
Sequence: QLSGLAQSEESSLDVDHQ | ||||||
Compositional bias | 540-554 | Polar residues | ||||
Sequence: DAPRSITNLNNPSEE | ||||||
Compositional bias | 558-582 | Basic and acidic residues | ||||
Sequence: MSLHLGDREPKRLRSDSGSSLDLEK |
Polymorphism
A partial loss-of-function allele of NAL1 is associated with high photosynthesis rate, high number of spikelets and high grain yield.
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU093963 EMBL· GenBank· DDBJ | ABW89000.1 EMBL· GenBank· DDBJ | mRNA | ||
AP008210 EMBL· GenBank· DDBJ | BAF15780.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP014960 EMBL· GenBank· DDBJ | BAS90996.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CM000141 EMBL· GenBank· DDBJ | EEE61678.1 EMBL· GenBank· DDBJ | Genomic DNA |