B4MVH6 · SG111_DROWI
- ProteinSAGA-associated factor 11 homolog 1
- GeneSgf11-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids209 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histone H2B. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Binds independently on SAGA to promoters in an RNA-dependent manner. Binds to mRNA and is essential for total mRNA export from the nucleus. Required to counteract heterochromatin silencing. Controls the development of neuronal connectivity in visual system by being required for accurate axon targeting in the optic lobe. Required for expression of ecdysone-induced genes such as br/broad.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | DUBm complex | |
Cellular Component | nuclear pore | |
Cellular Component | nucleoplasm | |
Cellular Component | SAGA complex | |
Molecular Function | nuclear receptor coactivator activity | |
Molecular Function | zinc ion binding | |
Biological Process | chromatin organization | |
Biological Process | mRNA export from nucleus | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | protein transport | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSAGA-associated factor 11 homolog 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionB4MVH6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to nuclear periphery, in contact with the nuclear pore complex (NPC).
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000367532 | 1-209 | SAGA-associated factor 11 homolog 1 | |||
Sequence: MSRTIVVKNPRTSGKDEDKAQIPSQDELPSGSSGAKTTNQIISEFRALIKDPIKLDEAVNYLYETLVDDAAVGIFIETRQLQKTGSLTALEGTVEETNDMCDLPDCDIFGMSTAEKTAKCCCPNCERMVAAVRFAPHLQTCLGLGRSSSRAALRRLTVSSRSSSTSTGGGQANEKSTDDEDWSLDSRPGKSTKNSRNKGSKKNQKNKLK |
Interaction
Subunit
Component of some SAGA transcription coactivator-HAT complexes, at least composed of Ada2b, not/nonstop, Pcaf/Gcn5, Sgf11 and Spt3. Within the SAGA complex, Sgf11, e(y)2, and not/nonstop form an additional subcomplex of SAGA called the DUB module (deubiquitination module). Interacts directly with not/nonstop. Interacts with the AMEX complex component xmas-2. Interacts with Cbp80; important for promoter recruitment of Sgf11 that is not associated with the DUB module.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, zinc finger, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-36 | Disordered | ||||
Sequence: MSRTIVVKNPRTSGKDEDKAQIPSQDELPSGSSGAK | ||||||
Zinc finger | 120-141 | SGF11-type | ||||
Sequence: CCCPNCERMVAAVRFAPHLQTC | ||||||
Compositional bias | 156-173 | Polar residues | ||||
Sequence: LTVSSRSSSTSTGGGQAN | ||||||
Region | 156-209 | Disordered | ||||
Sequence: LTVSSRSSSTSTGGGQANEKSTDDEDWSLDSRPGKSTKNSRNKGSKKNQKNKLK | ||||||
Compositional bias | 194-209 | Basic residues | ||||
Sequence: NSRNKGSKKNQKNKLK |
Domain
The long N-terminal helix forms part of the 'assembly lobe' of the SAGA deubiquitination module.
The C-terminal SGF11-type zinc-finger domain together with the C-terminal catalytic domain of not/nonstop forms the 'catalytic lobe' of the SAGA deubiquitination module.
Sequence similarities
Belongs to the SGF11 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length209
- Mass (Da)22,684
- Last updated2008-09-23 v1
- Checksum110ABCF23F669012
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 156-173 | Polar residues | ||||
Sequence: LTVSSRSSSTSTGGGQAN | ||||||
Compositional bias | 194-209 | Basic residues | ||||
Sequence: NSRNKGSKKNQKNKLK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CH963857 EMBL· GenBank· DDBJ | EDW75696.1 EMBL· GenBank· DDBJ | Genomic DNA |