B4DV28 · B4DV28_HUMAN
- ProteinCytosolic non-specific dipeptidase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids463 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Catalytic activity
- (S)-lactate + L-phenylalanine = H2O + N-[(S)-lactoyl]-L-phenylalanineThis reaction proceeds in the forward and the backward directions.
- H2O + L-cysteinylglycine = glycine + L-cysteineThis reaction proceeds in the forward direction.
- H2O + L-seryl-L-threonine = L-serine + L-threonineThis reaction proceeds in the forward direction.
- H2O + L-threonyl-L-serine = L-serine + L-threonineThis reaction proceeds in the forward direction.
- H2O + L-threonyl-L-threonine = 2 L-threonineThis reaction proceeds in the forward direction.
Cofactor
Note: Binds 2 manganese ions per subunit.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 99 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Active site | 101 | |||||
Sequence: D | ||||||
Binding site | 120 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 120 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Active site | 154 | Proton acceptor | ||||
Sequence: E | ||||||
Binding site | 155 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 183 | Mn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 183 | substrate; ligand shared between homodimeric partners; in other chain | ||||
Sequence: D | ||||||
Binding site | 216 | substrate; ligand shared between homodimeric partners | ||||
Sequence: H | ||||||
Site | 216 | Important for catalytic activity | ||||
Sequence: H | ||||||
Binding site | 318 | substrate; ligand shared between homodimeric partners | ||||
Sequence: T | ||||||
Binding site | 331 | substrate; ligand shared between homodimeric partners; in other chain | ||||
Sequence: R | ||||||
Binding site | 405 | substrate; ligand shared between homodimeric partners; in other chain | ||||
Sequence: S | ||||||
Binding site | 433 | Mn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 433 | substrate; ligand shared between homodimeric partners; in other chain | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | carboxypeptidase activity | |
Molecular Function | metal ion binding | |
Molecular Function | metallodipeptidase activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCytosolic non-specific dipeptidase
- EC number
- Alternative names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionB4DV28
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 196-354 | Peptidase M20 dimerisation | ||||
Sequence: YGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTPEVVGEQVTSYLTKKFA |
Sequence similarities
Belongs to the peptidase M20A family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length463
- Mass (Da)51,502
- Last updated2008-09-23 v1
- Checksum4A3998A10B2397B6