B3SRV3 · NSP3_ROTHP
- ProteinNon-structural protein 3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids310 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Plays an important role in stimulating the translation of viral mRNAs. These mRNAs are capped but not polyadenylated, instead terminating in a conserved sequence 'GACC' at the 3' that is recognized by NSP3, which competes with host PABPC1 for EIF4G1 binding. The interaction between NSP3 and host EIF4G1 stabilizes the EIF4E-EIF4G1 interaction, thereby facilitating the initiation of capped mRNA translation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Molecular Function | RNA binding | |
Biological Process | regulation of translation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNon-structural protein 3
- Short namesNSP3
- Alternative names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Duplornaviricota > Resentoviricetes > Reovirales > Sedoreoviridae > Rotavirus > Rotavirus A
- Virus hosts
Accessions
- Primary accessionB3SRV3
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000369457 | 1-310 | Non-structural protein 3 | |||
Sequence: MESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNEVFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSIIKCTRLMKDKIERGEVEVDDSYVDEKMEIDTIDWKSRYDQLEKRFESLKQRVSEKYNTWVQKAKKVNENMYSLQNVISQQQNQIADLQQYCNKLEADLQGKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIESLIRNLIQDYDRTFLMLKGLLKQCNYEYAYE |
Interaction
Subunit
Homodimer. Interacts (via the coiled-coil region) with host ZC3H7B (via LD motif). Interacts with host EIF4G1.
Family & Domains
Features
Showing features for region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-146 | RNA-binding | ||||
Sequence: MESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNEVFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSIIKCTRLMKDKIER | ||||||
Region | 147-203 | Dimerization | ||||
Sequence: GEVEVDDSYVDEKMEIDTIDWKSRYDQLEKRFESLKQRVSEKYNTWVQKAKKVNENM | ||||||
Coiled coil | 163-234 | |||||
Sequence: DTIDWKSRYDQLEKRFESLKQRVSEKYNTWVQKAKKVNENMYSLQNVISQQQNQIADLQQYCNKLEADLQGK | ||||||
Region | 167-231 | Interaction with host ZC3H7B | ||||
Sequence: WKSRYDQLEKRFESLKQRVSEKYNTWVQKAKKVNENMYSLQNVISQQQNQIADLQQYCNKLEADL | ||||||
Region | 205-310 | Interaction with host EIF4G1 | ||||
Sequence: SLQNVISQQQNQIADLQQYCNKLEADLQGKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIESLIRNLIQDYDRTFLMLKGLLKQCNYEYAYE |
Sequence similarities
Belongs to the rotavirus NSP3 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length310
- Mass (Da)35,826
- Last updated2008-09-02 v1
- ChecksumF756CB2EBF997FFE