B2RXZ1 · PNDC1_MOUSE
- ProteinPoly(A)-specific ribonuclease PNLDC1
- GenePnldc1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids531 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails (PubMed:27515512).
Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development (PubMed:27515512).
May act as a regulator of multipotency in embryonic stem cells (PubMed:27515512).
Is a critical factor for proper spermatogenesis, involved in pre-piRNAs processing to generate mature piRNAs (By similarity).
Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development (PubMed:27515512).
May act as a regulator of multipotency in embryonic stem cells (PubMed:27515512).
Is a critical factor for proper spermatogenesis, involved in pre-piRNAs processing to generate mature piRNAs (By similarity).
Catalytic activity
Cofactor
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | nucleus | |
Molecular Function | 3'-5'-RNA exonuclease activity | |
Molecular Function | metal ion binding | |
Molecular Function | poly(A)-specific ribonuclease activity | |
Molecular Function | RNA binding | |
Biological Process | blastocyst formation | |
Biological Process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | |
Biological Process | nuclear-transcribed mRNA poly(A) tail shortening | |
Biological Process | piRNA processing | |
Biological Process | priRNA 3'-end processing | |
Biological Process | siRNA 3'-end processing | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePoly(A)-specific ribonuclease PNLDC1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionB2RXZ1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Note: Localizes mainly in the endoplasmic reticulum.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 506-526 | Helical | ||||
Sequence: ITCLLQVCSIVTTWAMIAFLL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000439351 | 1-531 | Poly(A)-specific ribonuclease PNLDC1 | |||
Sequence: MDVGADEFEQSLPLLQELVAGADFVGLDIEFTGLRSNLSRPQQISLFDLPSEWYLKTRQSVQQFTICQIGLSMFSSIEGESNKYVAHSCNFFLFPTTFGILDSEFSFQASSVQFLNQYGFDYNKFLKNGIPYMNEEQEKKIKHSILRGNWRVRSSLDKDQIKVVIDKVTQWLDLAEEGDQMTLPGIAGFQAFEVQLVLRQALPNIWTVLKEEWVIVKKVSQPQRWYLEHASCDQVSCWKEQILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKNVTKDIWKELRFPRVSNLLEVYEVLSSNLNPTKDSGPVIIHARQCKKYAETKCPHEAAYDAFLCGSVLLKVAHLLLQRVHGNGAVHEPAFPQYLDVLAPYVNQVNLIRAGVPKINFSGPDYPSIRPPVLILTVKRWPGVSEQQVYREFQNLCKFDVRRFTRSQFLLLTNKFKDARSVLKEYRNHPTLQVSLYRSWRHSPNITCLLQVCSIVTTWAMIAFLLGRPMP |
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in embryonic stem cells (PubMed:27515512).
Highly expressed in testis (PubMed:26919431, PubMed:27515512).
Highly expressed in testis (PubMed:26919431, PubMed:27515512).
Induction
Down-regulated in differentiated cells, due to methylation of its promoter by the methyltransferase DNMT3B.
Developmental stage
Expressed during early embryo development and fades during differentiation.
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length531
- Mass (Da)61,292
- Last updated2008-07-01 v1
- Checksum5D0DB6502327E239
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3B2WCA0 | A0A3B2WCA0_MOUSE | Pnldc1 | 34 | ||
A0A3B2WCS3 | A0A3B2WCS3_MOUSE | Pnldc1 | 261 | ||
A0A3B2WD45 | A0A3B2WD45_MOUSE | Pnldc1 | 25 | ||
A0A3B2WCF7 | A0A3B2WCF7_MOUSE | Pnldc1 | 315 | ||
A0A3B2WD69 | A0A3B2WD69_MOUSE | Pnldc1 | 206 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL589878 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC158033 EMBL· GenBank· DDBJ | AAI58034.1 EMBL· GenBank· DDBJ | mRNA |