B2RHG4 · MFA4_PORG3
- ProteinMinor fimbrium tip subunit MfA4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids333 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Tip subunit of the minor fimbriae. These filamentous pili are attached to the cell surface; they mediate biofilm formation, adhesion onto host cells and onto other bacteria that are part of the oral microbiome (PubMed:19589838, PubMed:26001707).
They play an important role in invasion of periodontal tissues and are recognized as major virulence factors (Probable)
They play an important role in invasion of periodontal tissues and are recognized as major virulence factors (Probable)
Miscellaneous
The name (minor fimbrium subunit) does not indicate the abundance of the protein, but is derived from the greater length of the major fimbriae. In strain ATCC 33277 and strain ATCC BAA-1703 / FDC 381, major fimbriae are 300 - 1600 nM in length and about 5 nm in diameter. In contrast, minor fimbriae are only about 80 - 120 nm long. This length difference is observed only in a small number of strains, including strain ATCC 33277 and strain ATCC BAA-1703 / FDC 381, and is due to a loss of function mutation in FimB, a protein that restricts fimbrial length in other strains.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 53-54 | Cleavage; by gingipain | ||||
Sequence: RN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell outer membrane | |
Cellular Component | pilus |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMinor fimbrium tip subunit MfA4
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Bacteroidota > Bacteroidia > Bacteroidales > Porphyromonadaceae > Porphyromonas
Accessions
- Primary accessionB2RHG4
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Targeted to the outer membrane as a palmitoylated precursor. The lipid modification is no longer present after proteolytic processing to the mature form.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No effect on autoaggregation.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 53 | Abolishes cleavage site. | ||||
Sequence: R → A |
PTM/Processing
Features
Showing features for signal, lipidation, propeptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MKKYLLYASLLTSVLLFS | ||||||
Lipidation | 19 | N-palmitoyl cysteine | ||||
Sequence: C | ||||||
Lipidation | 19 | S-diacylglycerol cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000436796 | 19-53 | ||||
Sequence: CSKNNPSEPVEDRSIEISIRVDDFTKTGETVRYER | ||||||
Chain | PRO_0000436797 | 54-333 | Minor fimbrium tip subunit MfA4 | |||
Sequence: NQGSAAERLITNLYLLLFDQSGANPAKYYIAGNTFSGGIWLPDDMKVKLDMTQSEAGERKVYVVANVDNAVKTALDAVANESDLQTVKRTTAMPWSTDIASPFLMSGNKTHDFLANRLLDNVPLVRAIAKVELNISLSEKFQIVPIIVNGSLSEFKFRYVNFDKETYVVKPTTKPDNLISSANGVWPQITDWTVWGASLNTSPAPDAGTGYTLDANGKVTALRIVTYLNERDSKGATVEVALPRVDDGTLPPPEFGPELYRLPLPDKILRNHWYKYEVEI |
Keywords
- PTM
Interaction
Subunit
Component of the fimbrium tip. Minor fimbriae are composed of a structural subunit, most often Mfa1, and the accessory subunits Mfa3, Mfa4 and Mfa5 (PubMed:19589838, PubMed:24118823, PubMed:26001707, PubMed:26437277, PubMed:26972441).
Mfa4 is required for Mfa3 and Mfa5 insertion into the fimbrium (PubMed:26437277).
Fimbrium assembly occurs by linear, head-to-tail oligomerization of fimbrial subunits. This is mediated via insertion of a C-terminal beta-strand from one subunit into a groove in the N-terminal domain of the following subunit (PubMed:26972441).
Mfa4 is required for Mfa3 and Mfa5 insertion into the fimbrium (PubMed:26437277).
Fimbrium assembly occurs by linear, head-to-tail oligomerization of fimbrial subunits. This is mediated via insertion of a C-terminal beta-strand from one subunit into a groove in the N-terminal domain of the following subunit (PubMed:26972441).
Structure
Family & Domains
Sequence similarities
Belongs to the bacteroidetes fimbrillin superfamily. FimA/Mfa1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length333
- Mass (Da)37,110
- Last updated2008-07-01 v1
- Checksum9600624B8E1E6A26
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP009380 EMBL· GenBank· DDBJ | BAG32809.1 EMBL· GenBank· DDBJ | Genomic DNA |