B2R8A1 · B2R8A1_HUMAN
- ProteinSuccinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
- GeneSUCLG1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids333 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
Catalytic activity
- ATP + CoA + succinate = ADP + phosphate + succinyl-CoA
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle; succinate from succinyl-CoA (ligase route): step 1/1.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 51-54 | CoA (UniProtKB | ChEBI) | ||||
Sequence: TGKQ | ||||||
Binding site | 77 | CoA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 130-132 | CoA (UniProtKB | ChEBI) | ||||
Sequence: ITE | ||||||
Binding site | 194 | substrate; ligand shared with subunit beta | ||||
Sequence: Y | ||||||
Active site | 286 | Tele-phosphohistidine intermediate | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | succinate-CoA ligase complex (ADP-forming) | |
Molecular Function | nucleotide binding | |
Molecular Function | succinate-CoA ligase (ADP-forming) activity | |
Molecular Function | succinate-CoA ligase (GDP-forming) activity | |
Biological Process | tricarboxylic acid cycle |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSuccinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionB2R8A1
Subcellular Location
PTM/Processing
Proteomic databases
Interaction
Subunit
Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with the ATP-specific beta subunit SUCLA2, forms an ADP-forming succinyl-CoA synthetase (A-SCS). Together with the GTP-specific beta subunit SUCLG2 forms a GDP-forming succinyl-CoA synthetase (G-SCS).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 38-134 | CoA-binding | ||||
Sequence: YVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCITEGI |
Sequence similarities
Belongs to the succinate/malate CoA ligase alpha subunit family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length333
- Mass (Da)35,081
- Last updated2008-07-01 v1
- Checksum7E7167FAD3462982