B2GV24 · UFL1_RAT
- ProteinE3 UFM1-protein ligase 1
- GeneUfl1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids793 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
E3 protein ligase that mediates ufmylation, the covalent attachment of the ubiquitin-like modifier UFM1 to lysine residues on target proteins, and which plays a key role in various processes, such as ribosome recycling, response to DNA damage, interferon response or reticulophagy (also called ER-phagy) (By similarity).
Catalyzes ufmylation of many protein, such as CD274/PD-L1, CDK5RAP3, CYB5R3, DDRGK1, EIF6, histone H4, MRE11, P4HB, PDCD1/PD-1, TRIP4, RPN1, RPS20/uS10, RPL10/uL16, RPL26/uL24, SYVN1/HRD1 and TP53/p53 (By similarity).
As part of the UREL complex, plays a key role in ribosome recycling by catalyzing mono-ufmylation of RPL26/uL24 subunit of the 60S ribosome (By similarity).
Ufmylation of RPL26/uL24 occurs on free 60S ribosomes following ribosome dissociation: it weakens the junction between post-termination 60S subunits and SEC61 translocons, promoting release and recycling of the large ribosomal subunit from the endoplasmic reticulum membrane (By similarity).
Ufmylation of RPL26/uL24 and subsequent 60S ribosome recycling either take place after normal termination of translation or after ribosome stalling during cotranslational translocation at the endoplasmic reticulum (By similarity).
Involved in reticulophagy in response to endoplasmic reticulum stress by mediating ufmylation of proteins such as CYB5R3 and RPN1, thereby promoting lysosomal degradation of ufmylated proteins (By similarity).
Ufmylation in response to endoplasmic reticulum stress is essential for processes such as hematopoiesis, blood vessel morphogenesis or inflammatory response (By similarity).
Mediates ufmylation of DDRGK1 and CDK5RAP3; the role of these modifications is however unclear: as both DDRGK1 and CDK5RAP3 act as substrate adapters for ufmylation, it is uncertain whether ufmylation of these proteins is, a collateral effect or is required for ufmylation (By similarity).
Acts as a negative regulator of T-cell activation by mediating ufmylation and stabilization of PDCD1/PD-1 (By similarity).
Also involved in the response to DNA damage: recruited to double-strand break sites following DNA damage and mediates monoufmylation of histone H4 and ufmylation of MRE11 (By similarity).
Mediates ufmylation of TP53/p53, promoting its stability (By similarity).
Catalyzes ufmylation of TRIP4, thereby playing a role in nuclear receptor-mediated transcription (By similarity).
Required for hematopoietic stem cell function and hematopoiesis (By similarity).
Catalyzes ufmylation of many protein, such as CD274/PD-L1, CDK5RAP3, CYB5R3, DDRGK1, EIF6, histone H4, MRE11, P4HB, PDCD1/PD-1, TRIP4, RPN1, RPS20/uS10, RPL10/uL16, RPL26/uL24, SYVN1/HRD1 and TP53/p53 (By similarity).
As part of the UREL complex, plays a key role in ribosome recycling by catalyzing mono-ufmylation of RPL26/uL24 subunit of the 60S ribosome (By similarity).
Ufmylation of RPL26/uL24 occurs on free 60S ribosomes following ribosome dissociation: it weakens the junction between post-termination 60S subunits and SEC61 translocons, promoting release and recycling of the large ribosomal subunit from the endoplasmic reticulum membrane (By similarity).
Ufmylation of RPL26/uL24 and subsequent 60S ribosome recycling either take place after normal termination of translation or after ribosome stalling during cotranslational translocation at the endoplasmic reticulum (By similarity).
Involved in reticulophagy in response to endoplasmic reticulum stress by mediating ufmylation of proteins such as CYB5R3 and RPN1, thereby promoting lysosomal degradation of ufmylated proteins (By similarity).
Ufmylation in response to endoplasmic reticulum stress is essential for processes such as hematopoiesis, blood vessel morphogenesis or inflammatory response (By similarity).
Mediates ufmylation of DDRGK1 and CDK5RAP3; the role of these modifications is however unclear: as both DDRGK1 and CDK5RAP3 act as substrate adapters for ufmylation, it is uncertain whether ufmylation of these proteins is, a collateral effect or is required for ufmylation (By similarity).
Acts as a negative regulator of T-cell activation by mediating ufmylation and stabilization of PDCD1/PD-1 (By similarity).
Also involved in the response to DNA damage: recruited to double-strand break sites following DNA damage and mediates monoufmylation of histone H4 and ufmylation of MRE11 (By similarity).
Mediates ufmylation of TP53/p53, promoting its stability (By similarity).
Catalyzes ufmylation of TRIP4, thereby playing a role in nuclear receptor-mediated transcription (By similarity).
Required for hematopoietic stem cell function and hematopoiesis (By similarity).
GO annotations
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 UFM1-protein ligase 1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionB2GV24
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Recruited to double-strand breaks by the MRE11-RAD50-NBN (MRN) complex following DNA damage.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000391875 | 2-793 | E3 UFM1-protein ligase 1 | |||
Sequence: ADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQLEVVHTLDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLTHIENRVGDIIKSEKHVQMVLGQLVDENYLDRLSEEVNDKLQESGQVTVSELCKTYDLPGDFLTQALTQRLGRIINGHLDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLVSKYGFQEQLLYSVLEELVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVNYIKKRYKNTPLLFLKATCVGQGLVDQVEASVEEAISSGTWVDVSPLLPSSLSVEDAAMLLQQVMRPFGKHASATVFSDTVVVSEKFINDCTKLFSERMHQKAEKEMKNNPVHLITEEDLKQISILESVNTNKKDKKDERRKKATEGSGSVRGGGGGNAREYKIKKVKKKGRKDEDSDDESQSSHAGKKKPDITFMFQDEIEGCLRKHIPDAPEEFISELAEHLIKPLNKMYLEVVRSVFMSSTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKYFADDTQTALTKHLLKTVCTDITNLMFNFLASDLMMAVEDPATITSDMRKKILSKLTEETKVALTKLHNSLNEKSIEDFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALADQLKVTEDPALILHLTSVLLFQFSTHSMLHAPGRCVPQIIAFLHNKIPEDQHTLLVKYQGLVVKQLVSQNKKSGQGEDPSSDDLDKEQHDVTNTTRKELQELSLSIKDLVLKPRKSSVTEE | ||||||
Modified residue | 433 | Omega-N-methylarginine | ||||
Sequence: R | ||||||
Modified residue | 458 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 462 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 535 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 752 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 753 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Ubiquitinated, leading to its degradation by the proteasome. Interaction with CDK5RAP3 protects both proteins against ubiquitination and degradation via the proteasome.
Phosphorylated at Ser-462 by ATM, enhancing protein ligase activity and promoting ATM activation in a positive feedback loop. Phosphorylation at Thr-535 by AMPK promotes its interaction with YWHAG/14-3-3-gamma, thereby preventing UFL1 association with PDCD1/PD-1 substrate.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed with expression detected in brain, skeletal muscle, lung, heart, gall bladder, liver, small intestine, pancreas, spleen and kidney (at protein level) (PubMed:20228063).
At 8 weeks after birth, high expression in the Purkinje cell layer of the cerebellum (PubMed:20531390).
At 8 weeks after birth, high expression in the Purkinje cell layer of the cerebellum (PubMed:20531390).
Gene expression databases
Interaction
Subunit
Catalytic component of the UFM1 ribosome E3 ligase (UREL) complex, composed of UFL1, DDRGK1 and CDK5RAP3 (PubMed:20531390).
Interacts with E2-like enzyme UFC1 (By similarity).
Interacts with RELA (By similarity).
Interacts with NBN; promoting recruitment to double-strand breaks following DNA damage (By similarity).
Interacts (when phosphorylated) with YWHAG/14-3-3-gamma; sequestering UFL1 and preventing its association with PDCD1/PD-1 substrate (By similarity).
Interacts with E2-like enzyme UFC1 (By similarity).
Interacts with RELA (By similarity).
Interacts with NBN; promoting recruitment to double-strand breaks following DNA damage (By similarity).
Interacts (when phosphorylated) with YWHAG/14-3-3-gamma; sequestering UFL1 and preventing its association with PDCD1/PD-1 substrate (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 2-200 | Mediates interaction with DDRGK1 | ||||
Sequence: ADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQLEVVHTLDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLTHIENRVGDIIKSEKHVQMVLGQLVDENYLDRLSEEVNDKLQESGQVTVSELCKTYDLPGDFLTQALTQRLGRIINGHLDLDNRGVIFTEAFVARHKARIRGLFSAITRP | ||||||
Region | 2-212 | Required for E3 UFM1-protein ligase activity | ||||
Sequence: ADAWEEIRRLAADFQRAQFAESTQRLSERNCIEIVNKLISQKQLEVVHTLDGKEYITPAQISKEMRDELHVRGGRVNIVDLQQVINVDLTHIENRVGDIIKSEKHVQMVLGQLVDENYLDRLSEEVNDKLQESGQVTVSELCKTYDLPGDFLTQALTQRLGRIINGHLDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLVSKYGF | ||||||
Region | 121-250 | Involved in CDK5RAP3-binding | ||||
Sequence: DRLSEEVNDKLQESGQVTVSELCKTYDLPGDFLTQALTQRLGRIINGHLDLDNRGVIFTEAFVARHKARIRGLFSAITRPTAVNSLVSKYGFQEQLLYSVLEELVSTGRLRGTVVGGRQDKAVFVPDIYS | ||||||
Region | 200-400 | Mediates interaction with TRIP4 | ||||
Sequence: PTAVNSLVSKYGFQEQLLYSVLEELVSTGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFFRQNGYLEFDALSRLGIPDAVNYIKKRYKNTPLLFLKATCVGQGLVDQVEASVEEAISSGTWVDVSPLLPSSLSVEDAAMLLQQVMRPFGKHASATVFSDTVVVSEKFINDCTKLFSERMHQKAEKEMKNNPVHLITEED | ||||||
Region | 410-473 | Disordered | ||||
Sequence: VNTNKKDKKDERRKKATEGSGSVRGGGGGNAREYKIKKVKKKGRKDEDSDDESQSSHAGKKKPD | ||||||
Compositional bias | 411-428 | Basic and acidic residues | ||||
Sequence: NTNKKDKKDERRKKATEG | ||||||
Compositional bias | 449-473 | Basic and acidic residues | ||||
Sequence: KKKGRKDEDSDDESQSSHAGKKKPD | ||||||
Region | 490-683 | Mediates interaction with CDK5RAP3 | ||||
Sequence: IPDAPEEFISELAEHLIKPLNKMYLEVVRSVFMSSTSASGTGRKRTIKDLQEEVSNLYNNIRLFEKGMKYFADDTQTALTKHLLKTVCTDITNLMFNFLASDLMMAVEDPATITSDMRKKILSKLTEETKVALTKLHNSLNEKSIEDFLSCLDSATEACDIMVKKGDKKRERQILFQHRQALADQLKVTEDPAL | ||||||
Region | 742-769 | Disordered | ||||
Sequence: NKKSGQGEDPSSDDLDKEQHDVTNTTRK | ||||||
Compositional bias | 748-768 | Basic and acidic residues | ||||
Sequence: GEDPSSDDLDKEQHDVTNTTR |
Sequence similarities
Belongs to the UFL1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length793
- Mass (Da)89,585
- Last updated2008-06-10 v1
- ChecksumF99BB2764FD8F7DF
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2K266 | A0A0G2K266_RAT | Ufl1 | 713 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 411-428 | Basic and acidic residues | ||||
Sequence: NTNKKDKKDERRKKATEG | ||||||
Compositional bias | 449-473 | Basic and acidic residues | ||||
Sequence: KKKGRKDEDSDDESQSSHAGKKKPD | ||||||
Compositional bias | 748-768 | Basic and acidic residues | ||||
Sequence: GEDPSSDDLDKEQHDVTNTTR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC166498 EMBL· GenBank· DDBJ | AAI66498.1 EMBL· GenBank· DDBJ | mRNA |