B1WBN7 · B1WBN7_RAT
- ProteinFAM20C
- GeneFam20c
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids579 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
Cofactor
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 264 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 280 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 301 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 301 | Mn2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 384-387 | ATP (UniProtKB | ChEBI) | ||||
Sequence: AAFL | ||||||
Active site | 453 | |||||
Sequence: D | ||||||
Binding site | 458 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 473 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 473 | Mn2+ (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular space | |
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Molecular Function | ATP binding | |
Molecular Function | calcium ion binding | |
Molecular Function | manganese ion binding | |
Molecular Function | protease binding | |
Molecular Function | protein kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | biomineral tissue development | |
Biological Process | dentinogenesis | |
Biological Process | enamel mineralization | |
Biological Process | odontoblast differentiation | |
Biological Process | osteoclast maturation | |
Biological Process | positive regulation of bone mineralization | |
Biological Process | positive regulation of osteoblast differentiation | |
Biological Process | regulation of fibroblast growth factor receptor signaling pathway | |
Biological Process | regulation of phosphorus metabolic process | |
Biological Process | skeletal system development |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionB1WBN7
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 37-79 | Disordered | ||||
Sequence: ATRSPGEPGCSCAQPAAEAAGPGWAQARSRPGESAGGDAGWPN | ||||||
Region | 107-155 | Disordered | ||||
Sequence: PAAEPVDHAPRGQELGSPPPRDSAHRPLLRDPGPGPRVPPHGPRGDGSL | ||||||
Domain | 348-564 | FAM20 C-terminal | ||||
Sequence: FFVSPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSGHRILDIMDMTVFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILAPLHQCCRIRRSTYLRLQLLAKEEYKLSLLMAESLQHDKVAPVLYQLHLEALDRRLRIVLQAVRDCVEKDGVSSV |
Sequence similarities
Belongs to the FAM20 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length579
- Mass (Da)65,615
- Last updated2008-05-20 v1
- ChecksumE35F287E37AB35ED
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I5ZV45 | A0A8I5ZV45_RAT | Fam20c | 650 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC161825 EMBL· GenBank· DDBJ | AAI61825.1 EMBL· GenBank· DDBJ | mRNA | ||
BK001522 EMBL· GenBank· DDBJ | DAA01891.1 EMBL· GenBank· DDBJ | mRNA |