B1JY43 · GLPK_BURO0
- ProteinGlycerol kinase
- GeneglpK
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids500 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn-glycerol 3-phosphate.
Catalytic activity
- ATP + glycerol = ADP + H+ + sn-glycerol 3-phosphate
Activity regulation
Inhibited by fructose 1,6-bisphosphate (FBP).
Pathway
Polyol metabolism; glycerol degradation via glycerol kinase pathway; sn-glycerol 3-phosphate from glycerol: step 1/1.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 13 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 13 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 13 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 14 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 15 | ATP (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 17 | ADP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 83 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 83 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 84 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 84 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 135 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 135 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 244 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 244 | sn-glycerol 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 245 | glycerol (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 266 | ADP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 266 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 309 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 309 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 313 | ATP (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 410 | ADP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 410 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 414 | ADP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | glycerol kinase activity | |
Biological Process | glycerol catabolic process | |
Biological Process | glycerol metabolic process | |
Biological Process | glycerol-3-phosphate metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlycerol kinase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Betaproteobacteria > Burkholderiales > Burkholderiaceae > Burkholderia > Burkholderia cepacia complex > Burkholderia orbicola
Accessions
- Primary accessionB1JY43
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_1000098720 | 1-500 | Glycerol kinase | |||
Sequence: MQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQPGWVEHDPQEIWSTQAGVAAEAVTRTGLNGTSIAAIGITNQRETTIVWDRETGQPVYNAIVWQDRRTADFCDSLKKQGLEAKVRAKTGLPIDSYFSATKIRWILDNVPGARDKARQGKLAFGTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTREWDSELLELLDIPRSMLPEVKASSEIYGHTKTTVFASKIPLAGIAGDQHAALFGQMCTTSGMVKNTYGTGCFLMMNTGDKPIESKNNLVTTIAWQIGDDVQYALEGSIFIAGAVVQWLRDGVGLIKTAAEIEALAASVPHTDGVYLVPAFAGLGAPHWNARARGSVFGVTRGTSAAHLARAALDAIAYQSLDVLAAMEADSGISIGELRVDGGASANDLLMQFQADLLGVDAVRPQITETTALGAAYLAGLAIGYWKNLDEVRDQWQLDRRFAPSMPKEQVEQRMAGWQRAVRAAKAWADDTQ |
Structure
Sequence
- Sequence statusComplete
- Length500
- Mass (Da)54,661
- Last updated2008-04-29 v1
- Checksum93324BE747D97438
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP000958 EMBL· GenBank· DDBJ | ACA91867.1 EMBL· GenBank· DDBJ | Genomic DNA |