B1ALA9 · B1ALA9_HUMAN
- ProteinRibose-phosphate pyrophosphokinase 1
- GenePRPS1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids285 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | magnesium ion binding | |
Biological Process | nucleotide biosynthetic process |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibose-phosphate pyrophosphokinase 1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionB1ALA9
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 161 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 147 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 192 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 205 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 212 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-103 | Ribose-phosphate pyrophosphokinase N-terminal | ||||
Sequence: IKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKG |
Sequence similarities
Belongs to the ribose-phosphate pyrophosphokinase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length285
- Mass (Da)31,392
- Last updated2018-06-20 v2
- ChecksumF1524257840C2AA2
Computationally mapped potential isoform sequences
There are 17 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P60891 | PRPS1_HUMAN | PRPS1 | 318 | ||
A0A2R8Y7H4 | A0A2R8Y7H4_HUMAN | PRPS1 | 321 | ||
A0A6Q8PFD1 | A0A6Q8PFD1_HUMAN | PRPS1 | 97 | ||
A0A6Q8PFD7 | A0A6Q8PFD7_HUMAN | PRPS1 | 85 | ||
A0A6Q8PG31 | A0A6Q8PG31_HUMAN | PRPS1 | 30 | ||
A0A6Q8PG33 | A0A6Q8PG33_HUMAN | PRPS1 | 49 | ||
A0A6Q8PG82 | A0A6Q8PG82_HUMAN | PRPS1 | 112 | ||
A0A6Q8PG13 | A0A6Q8PG13_HUMAN | PRPS1 | 52 | ||
A0A6Q8PGF9 | A0A6Q8PGF9_HUMAN | PRPS1 | 46 | ||
A0A6Q8PGX9 | A0A6Q8PGX9_HUMAN | PRPS1 | 65 | ||
A0A6Q8PGP2 | A0A6Q8PGP2_HUMAN | PRPS1 | 95 | ||
A0A6Q8PEU0 | A0A6Q8PEU0_HUMAN | PRPS1 | 104 | ||
A0A6Q8PHK9 | A0A6Q8PHK9_HUMAN | PRPS1 | 121 | ||
A0A6Q8PHI4 | A0A6Q8PHI4_HUMAN | PRPS1 | 92 | ||
A0A0A0MRQ9 | A0A0A0MRQ9_HUMAN | PRPS1 | 76 | ||
Q15244 | Q15244_HUMAN | PRPS1 | 40 | ||
B1ALA7 | B1ALA7_HUMAN | PRPS1 | 168 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL137787 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL772400 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |