B0YJ88 · B0YJ88_HUMAN
- ProteinRadixin
- GeneRDX
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids583 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Probably plays a crucial role in the binding of the barbed end of actin filaments to the plasma membrane.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | adherens junction | |
Cellular Component | apical part of cell | |
Cellular Component | cell tip | |
Cellular Component | cleavage furrow | |
Cellular Component | cytoskeleton | |
Cellular Component | filopodium | |
Cellular Component | microvillus | |
Cellular Component | midbody | |
Cellular Component | plasma membrane | |
Cellular Component | T-tubule | |
Molecular Function | actin binding | |
Molecular Function | cell adhesion molecule binding | |
Biological Process | apical protein localization | |
Biological Process | barbed-end actin filament capping | |
Biological Process | cellular response to platelet-derived growth factor stimulus | |
Biological Process | positive regulation of early endosome to late endosome transport | |
Biological Process | positive regulation of protein localization to early endosome | |
Biological Process | regulation of cell shape | |
Biological Process | regulation of organelle assembly |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameRadixin
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionB0YJ88
Organism-specific databases
Subcellular Location
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-295 | FERM | ||||
Sequence: INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRR | ||||||
Coiled coil | 158-185 | |||||
Sequence: LEQHKLTKEQWEERIQNWHEEHRGMLRE | ||||||
Region | 310-330 | Disordered | ||||
Sequence: REEKHQKQLERAQLENEKKKR | ||||||
Compositional bias | 376-400 | Basic and acidic residues | ||||
Sequence: DQERKRAKEEAERLEKERRAAEEAK | ||||||
Region | 376-407 | Disordered | ||||
Sequence: DQERKRAKEEAERLEKERRAAEEAKSAIAKQA | ||||||
Region | 462-526 | Disordered | ||||
Sequence: ELKTVMSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKK | ||||||
Compositional bias | 467-481 | Pro residues | ||||
Sequence: MSAPPPPPPPPVIPP | ||||||
Compositional bias | 482-496 | Basic and acidic residues | ||||
Sequence: TENEHDEHDENNAEA | ||||||
Compositional bias | 505-524 | Basic and acidic residues | ||||
Sequence: VMNHRSEEERVTETQKNERV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length583
- Mass (Da)68,564
- Last updated2008-04-08 v1
- Checksum889687E1D675FFE7
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 376-400 | Basic and acidic residues | ||||
Sequence: DQERKRAKEEAERLEKERRAAEEAK | ||||||
Compositional bias | 467-481 | Pro residues | ||||
Sequence: MSAPPPPPPPPVIPP | ||||||
Compositional bias | 482-496 | Basic and acidic residues | ||||
Sequence: TENEHDEHDENNAEA | ||||||
Compositional bias | 505-524 | Basic and acidic residues | ||||
Sequence: VMNHRSEEERVTETQKNERV |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EF445024 EMBL· GenBank· DDBJ | ACA06066.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK312903 EMBL· GenBank· DDBJ | BAG35749.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471065 EMBL· GenBank· DDBJ | EAW67130.1 EMBL· GenBank· DDBJ | Genomic DNA |