B0L3A2 · DESPR_HUMAN
- ProteinDual endothelin-1/VEGF signal peptide receptor
- GeneFBXW7-AS1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Does not act as a receptor for angiotensin-2 (PubMed:17446437).
Does not bind the VEGFA mature protein (By similarity).
May play a role in angiogenesis with a significant role in cardiovascular and neural development (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | endothelin receptor activity | |
Molecular Function | vascular endothelial growth factor binding | |
Biological Process | endothelin receptor signaling pathway | |
Biological Process | vascular endothelial growth factor signaling pathway |
Keywords
- Molecular function
It contributes to apoptosis resistance of pancreatic cancer stem-like cells (CSCs) and nonCSC-tumor cells. DEspR-inhibition attenuates pancreatic tumor cell dissemination in the intraperitoneal space, increasing median overall survival in xenograft nude rat model of pancreatic peritoneal carcinomatosis. DEspR-inhibition of Panc1-derived CSCs decreases xenograft tumor establishment of heterotopic flank tumor and peritoneal metastatic tumors. DEspR is not expressed in tumor-adjacent normal tissues.
DEspR+ neutrophils are increased by bacteriotoxin lipopolysaccharide (LPS)-TLR4 activation.
DEspR is expressed on activated CD11b+ neutrophils. DEspR+CD11b+ neutrophil levels correlate with the neutrophil lymphocyte ratio (NLR) and circulating levels of NET-forming neutrophils.
A neutrophil-subset in COVID19 patients expresses DEspR. DEspR[high] neutrophils are associated with critical illness in COVID19.
Names & Taxonomy
Protein names
- Recommended nameDual endothelin-1/VEGF signal peptide receptor
- Short namesDEspR protein ; Dual endothelin-1/VEGFsp receptor
- Alternative names
Gene names
- Community suggested namesDual Endothelin-1/signal peptide of VEGF-propeptide Receptor; DEspR.
- Community suggested namesDEspR
- Community suggested namesDEspR
- Community suggested namesDEspR
- Community suggested namesDEspR
- Community suggested namesDEspR; dual endothelin-1/signal peptide of pro-VEGF receptor.
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionB0L3A2
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-18 | Extracellular | ||||
Sequence: MTMFKGSNEMKSRWNWGS | ||||||
Transmembrane | 19-37 | Helical | ||||
Sequence: ITCIICFTCVGSQLSMSSS | ||||||
Topological domain | 38-85 | Cytoplasmic | ||||
Sequence: KASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000452831 | 1-85 | Dual endothelin-1/VEGF signal peptide receptor | |||
Sequence: MTMFKGSNEMKSRWNWGSITCIICFTCVGSQLSMSSSKASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV |
Post-translational modification
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length85
- Mass (Da)9,677
- Last updated2008-03-18 v1
- ChecksumFE2D2AA722F8EE1B
RNA Editing
Keywords
- Coding sequence diversity
- Technical term