B0FRF9 · KARG_PENVA
- ProteinArginine kinase Lit v 2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids356 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Catalyzes the reversible transfer of high energy ATP gamma-phosphate group to L-arginine.
Catalytic activity
- ATP + L-arginine = ADP + H+ + N(omega)-phospho-L-arginineThis reaction proceeds in the forward and the backward directions.
Activity regulation
No change in activity after supplementation with 10 mM glucose. However, activity decreases significantly when glucose concentration is higher than 50 mM and almost all activity is lost with 200 mM glucose. Activity is significantly increased after treatment with 10 mM and 50 mM ATP. However, activity drops significantly with 200 mM ATP. Inhibited by 10-200 mM alpha-ketoglutarate. No change in activity after incubation with 10-200 mM L-citrulline, L-ornaline or glycerol.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 64-68 | L-arginine (UniProtKB | ChEBI) | ||||
Sequence: GVGIY | ||||||
Binding site | 122-126 | ATP (UniProtKB | ChEBI) | ||||
Sequence: STRVR | ||||||
Binding site | 185 | ATP (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 225 | L-arginine (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 229 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 271 | L-arginine (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 280-284 | ATP (UniProtKB | ChEBI) | ||||
Sequence: RASVH | ||||||
Binding site | 309-314 | ATP (UniProtKB | ChEBI) | ||||
Sequence: RGTRGE | ||||||
Binding site | 314 | L-arginine (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | arginine kinase activity | |
Molecular Function | ATP binding | |
Molecular Function | creatine kinase activity | |
Biological Process | phosphocreatine biosynthetic process | |
Biological Process | phosphorylation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameArginine kinase Lit v 2
- EC number
- Alternative names
- Allergen nameLit v 2
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Crustacea > Multicrustacea > Malacostraca > Eumalacostraca > Eucarida > Decapoda > Dendrobranchiata > Penaeoidea > Penaeidae > Penaeus
Accessions
- Primary accessionB0FRF9
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human. Binds to IgE (Probable).
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for initiator methionine, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Chain | PRO_0000447431 | 2-356 | Arginine kinase Lit v 2 | |||
Sequence: ADAAVIEKLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQTDKHPNKDFGDVNSFVNVDPEGKFVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM |
Expression
Tissue specificity
Expressed in muscle (at protein level). Expressed in muscle, heart, nerve, stomach and hemocytes, with the highest expression in muscle. Very low expression in eyestalk and intestine. Not expressed in hepatopancreas, gill and skin.
Induction
By LPS immunostimulation. In hemocytes, expression increases sharply at 3 hours, decreases slightly at 6 hours, increases significantly again at 24 hours and decreases at 48 hours after LPS injection. In muscle, expressed less than the control in the first 6 hours, then the expression increases strikingly from 6 to 24 hours and decreases at 48 hours after LPS injection.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-91 | Phosphagen kinase N-terminal | ||||
Sequence: KLEAGFKKLEAATDCKSLLKKYLTKEVFDKLKDKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHV | ||||||
Domain | 119-356 | Phosphagen kinase C-terminal | ||||
Sequence: FVISTRVRCGRSMQGYPFNPCLTESQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM |
Sequence similarities
Belongs to the ATP:guanido phosphotransferase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length356
- Mass (Da)40,168
- Last updated2008-02-26 v1
- ChecksumE9C88AE671AB1BBB