A9QM73 · SMG7_ARATH
- ProteinNonsense-mediated mRNA decay factor SMG7
- GeneSMG7
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1059 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays multiple roles in growth and development. Involved in nonsense-mediated mRNA decay (NMD). May provide a link to the mRNA degradation machinery to initiate NMD and serve as an adapter for UPF proteins function. Required for meiotic progression through anaphase II of pollen mother cells. May counteract cyclin-dependent kinase (CDK) activity at the end of meiosis. May play a role in plant defense through its involvement in NMD. Together with EXA1, helps to restrict cell death induction during pathogen infection in a salicylic acid- (SA) and reactive oxygen species- (ROS) independent manner (PubMed:29073135).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | P-body | |
Biological Process | defense response | |
Biological Process | meiotic cell cycle | |
Biological Process | meiotic spindle assembly | |
Biological Process | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | |
Biological Process | programmed cell death | |
Biological Process | regulation of defense response |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNonsense-mediated mRNA decay factor SMG7
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA9QM73
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Embryonic lethality when homozygous (PubMed:18544632).
No spontaneous lesions, but enhanced cell death independent of salicylic acid (SA) biosynthesis or reactive oxygen species (ROS) production during pathogen infection (PubMed:29073135).
No spontaneous lesions, but enhanced cell death independent of salicylic acid (SA) biosynthesis or reactive oxygen species (ROS) production during pathogen infection (PubMed:29073135).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 933 | Abolished interaction with EXA1. | ||||
Sequence: G → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 77 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000422380 | 1-1059 | Nonsense-mediated mRNA decay factor SMG7 | |||
Sequence: MMTLQMDKTTASSSWERAKSIYDEIAELANKRQKAGNPPDPNLLQLLREKYEAIILESHTFSEQHNIEIPLWQLHYKRIEYFRLHINRVLASSTSTAAQNVKGPSKAEQIAQLKLQFRTFLSEATGFYHDMILKIRSKYGLPLGSFSEDQQSQNLSDKDGKELAEVQKALKSCHRCLIYLGDLARYKGMYAEGDSRSRQYASASSYYLQAASLWPASGNPHHQLAIVASYSRDEFVTTYRYFRSLAVEYPFPTARDNLIVAFDKNRQSYEKLFVPSKDSSKRLTGKGRGKGADISLKDATLVAGPEKDKVTIANEMLKAFSIRFVHLNGILFTRTSLETFFDVLASTSSSLREVISLGSAKELTLGIDTSDSALFIVRVVTMLIFSVHNSKKETEGQSYAEIVQRVEPARNSLTASFELLGLVIEKCVQLGDPSSSYFLPGVLVFVEWLACCPDIALGSDPDDRQTAVRNSFWNQFVVFFNQVLSLGPTFIDDVEDETCFSNMSLYDERETENRLALWEDYELRGFLPLLPAQTILNFSRKHSFGTEGPKEKKARIKRIFAAGKALTSVIKVDQNHVYFDSKKKKFLVGVKPADDFLDSHSSPPKACNALQDNQVMIDHNSPIMQLDQQIYMGEEDDDDEVIVFKPLVTEKRKEASDQIYVPSGGFRKSDQVTTMGDFKALSGSDVAFHENQILQARGNASIQVPASVGANLLGPLQPSTQSQAMHMQQVQTQVQVPASVGANLLGLLLTSTQSQAMHMQQVQTQAVNPQPAQSLAASRLQPIQSQVAQPLPSRVVHFQQTQAQVSHVSPAHSQSTSFGGGSKWSPEEAASLASSLSGFAQLGNGHVMRNEMQGNHGVSYYPAHSLPVHQSYNGNGMGGMPYSQSRTPEAVFPPKIDPVLSSGVVADGLGVQSSLAKKNPISRAFRHLGPPPGFNSVPAKLQKEPAPGSELSGNNHLPVDDYSWLDGYQAQSSRGVGLNSSLNYATSGKPEHLGSTGNGLNGPANFPFPGKQVPTSQVQADFPYFQNPQKDNFVDKNHQSTQLPEQYQGQSTWSSRHFV |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in flowers and at lower levels in stems and leaves.
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 149-183 | TPR 1 | ||||
Sequence: DQQSQNLSDKDGKELAEVQKALKSCHRCLIYLGDL | ||||||
Repeat | 184-217 | TPR 2 | ||||
Sequence: ARYKGMYAEGDSRSRQYASASSYYLQAASLWPAS | ||||||
Region | 806-826 | Disordered | ||||
Sequence: SHVSPAHSQSTSFGGGSKWSP | ||||||
Region | 927-955 | Disordered | ||||
Sequence: HLGPPPGFNSVPAKLQKEPAPGSELSGNN | ||||||
Compositional bias | 987-1002 | Polar residues | ||||
Sequence: SGKPEHLGSTGNGLNG | ||||||
Region | 987-1015 | Disordered | ||||
Sequence: SGKPEHLGSTGNGLNGPANFPFPGKQVPT | ||||||
Region | 1040-1059 | Disordered | ||||
Sequence: STQLPEQYQGQSTWSSRHFV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,059
- Mass (Da)117,006
- Last updated2011-05-03 v1
- Checksum8CC930F46B15847B
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BBV1 | A0A1P8BBV1_ARATH | SMG7 | 1027 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 987-1002 | Polar residues | ||||
Sequence: SGKPEHLGSTGNGLNG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU126544 EMBL· GenBank· DDBJ | ABW96769.1 EMBL· GenBank· DDBJ | mRNA | ||
AF296837 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002688 EMBL· GenBank· DDBJ | AED92699.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED92700.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | AED92701.1 EMBL· GenBank· DDBJ | Genomic DNA |