A9PL00 · A9PL00_POPTM
- ProteinAminomethyltransferase
- GenegdcT1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids408 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
The glycine cleavage system catalyzes the degradation of glycine.
Catalytic activity
- (6S)-5,6,7,8-tetrahydrofolate + N6-[(R)-S8-aminomethyldihydrolipoyl]-L-lysyl-[protein] = (6R)-5,10-methylene-5,6,7,8-tetrahydrofolate + N6-[(R)-dihydrolipoyl]-L-lysyl-[protein] + NH4+
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 235 | substrate | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | glycine cleavage complex | |
Cellular Component | mitochondrion | |
Molecular Function | aminomethyltransferase activity | |
Molecular Function | transaminase activity | |
Biological Process | glycine catabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAminomethyltransferase
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Malpighiales > Salicaceae > Saliceae > Populus
Accessions
- Primary accessionA9PL00
Subcellular Location
Interaction
Subunit
The glycine cleavage system is composed of four proteins: P, T, L and H.
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 41-296 | Aminomethyltransferase folate-binding | ||||
Sequence: LYDFHVANGGKMVPFAGWSMPIQYKDSIMESTVNCRQNGSLFDVSHMCGFSLKGKDCVPFLEKLVIADVAALAPGTGTLTVFTNEKGGAIDDSVITKVTDDHMYIVVNAGCKDKDLAHIEAHMKSFKAKGGDVSWHIHDERSLLALQGPLAAPVLQHLTKEDLSKVYFGEFRITDINGVRCFINRTGYTGEDGFEISVPSENAVDLAKATLEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLNWA | ||||||
Domain | 324-400 | Glycine cleavage T-protein C-terminal barrel | ||||
Sequence: RLVGFSSTGPPPRSHSEIQDEKGTSIGEITSGGFSPCLKKNIAMGYVKSGFHKSGTKAKILVRGKAYDGVVTKKPFV | ||||||
Region | 328-348 | Disordered | ||||
Sequence: FSSTGPPPRSHSEIQDEKGTS |
Sequence similarities
Belongs to the GcvT family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length408
- Mass (Da)44,336
- Last updated2008-02-05 v1
- Checksum8B9123A288BA1FDB