A9CB94 · CAP8_ADES1
- ProteinPre-hexon-linking protein VIII
- GeneL4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids278 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Hexon-linking protein-N
Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
Hexon-linking protein-C
Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
Miscellaneous
All late proteins expressed from the major late promoter are produced by alternative splicing and alternative polyadenylation of the same gene giving rise to non-overlapping ORFs. A leader sequence is present in the N-terminus of all these mRNAs and is recognized by the viral shutoff protein to provide expression although conventional translation via ribosome scanning from the cap has been shut off in the host cell.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 113-114 | Cleavage; by viral protease | ||||
Sequence: AS | ||||||
Site | 199-200 | Cleavage; by viral protease | ||||
Sequence: QL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell nucleus | |
Cellular Component | viral capsid | |
Molecular Function | hexon binding |
Names & Taxonomy
Protein names
- Recommended namePre-hexon-linking protein VIII
- Alternative names
- Cleaved into 2 chains
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Preplasmiviricota > Tectiliviricetes > Rowavirales > Adenoviridae > Atadenovirus > Snake atadenovirus A
- Virus hosts
Accessions
- Primary accessionA9CB94
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Hexon-linking protein-C
Note: Located on the inner side of the capsid shell. Present in 120 copies per virion.
Pre-hexon-linking protein VIII
Hexon-linking protein-N
Note: Located on the inner side of the capsid shell. Present in 120 copies per virion.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for peptide, chain, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Peptide | PRO_0000439697 | 1-113 | Hexon-linking protein-N | |||
Sequence: MEAPVTPYIWQYQPETGTAAGARQNYGAVINWLSSDNNMYHRVQEVNRQRNKIDDFREQTVRADMAHSFNDWKPQQLSQPASTAYLPAPNPIAGPRTIPDVIFTAEGEQLAGA | ||||||
Chain | PRO_0000425933 | 1-278 | Pre-hexon-linking protein VIII | |||
Sequence: MEAPVTPYIWQYQPETGTAAGARQNYGAVINWLSSDNNMYHRVQEVNRQRNKIDDFREQTVRADMAHSFNDWKPQQLSQPASTAYLPAPNPIAGPRTIPDVIFTAEGEQLAGASPSLLSGGASLPPSSYRLGDGREYRKFTRDAMPFPHNWLVKENGVWVPVEERDPLLSEEGRNALSSYPTLTYAQPPILRYRRLGQQLQGGGVVAPSSRVVSLLTEQPRMPRTEGMTPYQFSAEFPPVVYDHPFSRNLTLFPKEFSPLFDPKDQVLATSLATLQYR | ||||||
Propeptide | PRO_0000439698 | 114-199 | ||||
Sequence: SPSLLSGGASLPPSSYRLGDGREYRKFTRDAMPFPHNWLVKENGVWVPVEERDPLLSEEGRNALSSYPTLTYAQPPILRYRRLGQQ | ||||||
Peptide | PRO_0000439699 | 200-278 | Hexon-linking protein-C | |||
Sequence: LQGGGVVAPSSRVVSLLTEQPRMPRTEGMTPYQFSAEFPPVVYDHPFSRNLTLFPKEFSPLFDPKDQVLATSLATLQYR |
Post-translational modification
Cleaved by the viral protease during virion maturation. May cause the middle segment to be shed from the capsid.
Keywords
- PTM
Expression
Induction
Expressed in the late phase of the viral replicative cycle.
Keywords
- Developmental stage
Interaction
Subunit
Interacts with the peripentonal hexons as well as the hexons in the facets. Part of a complex composed of the core-capsid bridging protein, the endosome lysis protein VI and the hexon-linking protein VIII; these interactions bridge the virus core to the capsid.
Sequence
- Sequence statusComplete
- Length278
- Mass (Da)31,283
- Last updated2008-01-15 v1
- Checksum4E4EDE4E8EE860E1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ106414 EMBL· GenBank· DDBJ | ABA47244.1 EMBL· GenBank· DDBJ | Genomic DNA |