A9CB88 · PKG3_ADES1
- ProteinPackaging protein 3
- GeneL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids322 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Involved in viral genome packaging through its interaction with packaging proteins 1 and 2. After proteolytic cleavage by adenovirus protease, L1 52/55k protein is removed from the capsid during viral maturation.
Miscellaneous
All late proteins expressed from the major late promoter are produced by alternative splicing and alternative polyadenylation of the same gene giving rise to non-overlapping ORFs. A leader sequence is present in the N-terminus of all these mRNAs and is recognized by the viral shutoff protein to provide expression although conventional translation via ribosome scanning from the cap has been shut off in the host cell.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell nucleus | |
Biological Process | viral DNA genome packaging | |
Biological Process | viral release from host cell |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePackaging protein 3
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Preplasmiviricota > Tectiliviricetes > Rowavirales > Adenoviridae > Atadenovirus > Snake atadenovirus A
- Virus hosts
Accessions
- Primary accessionA9CB88
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Nuclear protein present in empty capsids and assembly intermediates.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000425921 | 1-322 | Packaging protein 3 | |||
Sequence: MHPILKNIRSQPDQGRAEEHNPELHCGIAGTGGLEEQLRSKQREDRFHKACPPAVDLNRDDTQLYGEGERDLRLKSSACVQLDRTPVTPEDFVPDDMGSRAIRQMEAAKLVRNGQHTRDVERWQHDTYCSHLTQLLVRPLTSLGVMYLADFLNTFVELPPNHTLTMQLVTIINHTSEPTLRRLLKDIGEKDAEGHLKNEWLLQLLSIIEMIFKDEPSERARLTALLTVTNEVALNFSKKASGGNYPTTDRLSKTLTYFRRMIVALLALAESLGCYTNNYCARKPEKRCRTQVEPSDESYMFSLKGALEAPESDEEEEEWIRD |
Post-translational modification
Cleaved at different sites by the viral protease during virion maturation.
Keywords
- PTM
Expression
Induction
Expressed in the early phase and late phase of the viral replicative cycle.
Keywords
- Developmental stage
Interaction
Subunit
Part of the genome packaging complex composed of packaging proteins 1, 2 and 3; this complex specifically binds to the packaging sequence on the left end of viral genomic DNA and performs packaging of the viral genome. Interacts with hexon-linking protein IIIa; this interaction is required to promote correct genome packaging.
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-24 | Disordered | ||||
Sequence: MHPILKNIRSQPDQGRAEEHNPEL | ||||||
Region | 1-127 | Interaction with packaging protein 1 | ||||
Sequence: MHPILKNIRSQPDQGRAEEHNPELHCGIAGTGGLEEQLRSKQREDRFHKACPPAVDLNRDDTQLYGEGERDLRLKSSACVQLDRTPVTPEDFVPDDMGSRAIRQMEAAKLVRNGQHTRDVERWQHDT |
Sequence similarities
Belongs to the adenoviridae packaging protein 3 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length322
- Mass (Da)36,790
- Last updated2008-01-15 v1
- Checksum5125CEACC3A071D1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ106414 EMBL· GenBank· DDBJ | ABA47238.1 EMBL· GenBank· DDBJ | Genomic DNA |