A8YPQ6 · A8YPQ6_STAAU
- ProteinCapsular biosynthesis protein
- GenecapA1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids222 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | carbohydrate:proton symporter activity | |
Molecular Function | protein tyrosine kinase activity | |
Biological Process | polysaccharide transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Staphylococcaceae > Staphylococcus
Accessions
- Primary accessionA8YPQ6
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 20-40 | Helical | ||||
Sequence: ILIILPLLFLIISAIVTFFVL | ||||||
Transmembrane | 172-192 | Helical | ||||
Sequence: VVNLIGAFFLGLVVALIYIFF |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 4-94 | Polysaccharide chain length determinant N-terminal | ||||
Sequence: TLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNPQFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDL |
Sequence similarities
Belongs to the CpsC/CapA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length222
- Mass (Da)24,854
- Last updated2008-01-15 v1
- ChecksumB6126E248D0112BA
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP023391 EMBL· GenBank· DDBJ | ATC70193.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CAIHOM010000002 EMBL· GenBank· DDBJ | CAC7004678.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CAIIGN010000002 EMBL· GenBank· DDBJ | CAC8223786.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AM902278 EMBL· GenBank· DDBJ | CAP16654.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BDVT01000002 EMBL· GenBank· DDBJ | GBV19647.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LALJ01000031 EMBL· GenBank· DDBJ | KMR35573.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LALQ01000021 EMBL· GenBank· DDBJ | KMR57358.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LFVK01000003 EMBL· GenBank· DDBJ | KSA77731.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LRQH01000202 EMBL· GenBank· DDBJ | KXA32211.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JAIUEN010000114 EMBL· GenBank· DDBJ | MCE3363145.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
WPRH01000602 EMBL· GenBank· DDBJ | MVI56480.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
WPTS01000035 EMBL· GenBank· DDBJ | MVK35802.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
WPXC01000017 EMBL· GenBank· DDBJ | MVM11102.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JAALTR010000359 EMBL· GenBank· DDBJ | NGW68630.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JAANDN010000041 EMBL· GenBank· DDBJ | NUY67696.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LNJK01000003 EMBL· GenBank· DDBJ | OWT16676.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
RQSX01000269 EMBL· GenBank· DDBJ | RZH91613.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UHBY01000003 EMBL· GenBank· DDBJ | SUL30611.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
QNXH01000001 EMBL· GenBank· DDBJ | TXL37496.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
QNXF01000003 EMBL· GenBank· DDBJ | TXL39894.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP152420 EMBL· GenBank· DDBJ | XAJ29332.1 EMBL· GenBank· DDBJ | Genomic DNA |