A8WGB1 · CCBE1_DANRE
- ProteinCollagen and calcium-binding EGF domain-containing protein 1
- Geneccbe1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids401 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis. Required for the formation of facial lymphatic structures (PubMed:37097004).
Necessary for lymphangiogenesis, but is probably not part of either the vegfc-vegfr3 signaling or sox18-prox1 transcriptional pathways
Necessary for lymphangiogenesis, but is probably not part of either the vegfc-vegfr3 signaling or sox18-prox1 transcriptional pathways
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | collagen trimer | |
Cellular Component | extracellular region | |
Molecular Function | calcium ion binding | |
Biological Process | blood vessel morphogenesis | |
Biological Process | lymph vessel development | |
Biological Process | lymphangiogenesis | |
Biological Process | sprouting angiogenesis | |
Biological Process | vascular endothelial growth factor signaling pathway | |
Biological Process | venous blood vessel morphogenesis | |
Biological Process | venous endothelial cell migration involved in lymph vessel development |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCollagen and calcium-binding EGF domain-containing protein 1
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA8WGB1
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Significant reduction in phosphorylated mapk/erk in the nuclei within the posterior cardinal vein endothelium at 32 hpf (PubMed:28179432).
Loss of facial lymphatic vessels including; lateral facial lymphatic vessel, medial facial lymphatic vessel, facial lymphatic branchial arches and otolithic lymphatic vessel at 5 dpf (PubMed:37097004).
In a svep1 and ccbe1 double knockout model there is complete loss of the facial lymphatic architecture at 5 dpf (PubMed:37097004).
Loss of facial lymphatic vessels including; lateral facial lymphatic vessel, medial facial lymphatic vessel, facial lymphatic branchial arches and otolithic lymphatic vessel at 5 dpf (PubMed:37097004).
In a svep1 and ccbe1 double knockout model there is complete loss of the facial lymphatic architecture at 5 dpf (PubMed:37097004).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 162 | In fof(hu3613); lacks the thoracic duct and the previously unidentified intersegmental (ISLVs) and dorsal longitudinal lymphatic vessels (DLLVs) but retains a seemingly normal blood vasculature. Mutants show edema, initiating in the lower intestine and around the eyes from 6 dpf. At 36 dpf, surviving mutants show severe edema. | ||||
Sequence: D → E |
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MIYPGRGASLSVAVALVLFSSG | ||||||
Chain | PRO_0000370636 | 23-401 | Collagen and calcium-binding EGF domain-containing protein 1 | |||
Sequence: APWTFREEKEDVDREVCSESKIATTKYPCVKSTGEVTTCYRKKCCEGFKFVLGQCIPEDYDVCAGAPCEQQCTDHFGRVVCTCYDGYRYDRERHRNREKPYCLDIDECANNNETVCSQMCVNTPGSYRCDCHSGFYLEDDGKTCTKGERAPLFEKSDNVMKEGTCSATCEDFHQMKMTVLQLKQKMSLLSSNTEINKQMTNEKMMMTTNSFLPGPPGPPGPAGTPGAKGSSGSPGQMGPPGLPGPRGDMGPIGPSPDLSHIKQGRRGPVGPPGAPGRDGMKGERGFPGPSGPPGPPGSFDFLLLMMADIRNDIAELQSKVFSRPLHSSFEDFPSAPDSWRDTPENLDFGSGEDYKSQSPPKSSRKRKLPRNLKNPDWPV | ||||||
Disulfide bond | 130↔142 | |||||
Sequence: CANNNETVCSQMC | ||||||
Glycosylation | 134 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 138↔151 | |||||
Sequence: CSQMCVNTPGSYRC | ||||||
Disulfide bond | 153↔166 | |||||
Sequence: CHSGFYLEDDGKTC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Not expressed in blood or lymphatic endothelial cells, correlating spatially and temporally with the migration routes of endothelial cells that bud from the PCV, migrate in association with somite boundaries and seed the horizontal myoseptum region from where lymphatic precursors later migrate.
Developmental stage
Restricted expression during development with expression in the pronephros and ventral mesenchyme at 24 hours post fertilization (hpf). By 36 hpf, expression is detected in discrete zones along each somitic boundary, between the PCV and the horizontal myoseptum, as well as along the horizontal myoseptum itself. At 48 hpf, expression is restricted along the horizontal myoseptum.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 126-167 | EGF-like; calcium-binding | ||||
Sequence: DIDECANNNETVCSQMCVNTPGSYRCDCHSGFYLEDDGKTCT | ||||||
Region | 229-321 | Disordered | ||||
Sequence: TTNSFLPGPPGPPGPAGTPGAKGSSGSPGQMGPPGLPGPRGDMGPIGPSPDLSHIKQGRRGPVGPPGAPGRDGMKGERGFPGPSGPPGPPGSF | ||||||
Domain | 234-276 | Collagen-like 1 | ||||
Sequence: LPGPPGPPGPAGTPGAKGSSGSPGQMGPPGLPGPRGDMGPIGP | ||||||
Domain | 286-319 | Collagen-like 2 | ||||
Sequence: GRRGPVGPPGAPGRDGMKGERGFPGPSGPPGPPG | ||||||
Region | 344-401 | Disordered | ||||
Sequence: SRPLHSSFEDFPSAPDSWRDTPENLDFGSGEDYKSQSPPKSSRKRKLPRNLKNPDWPV |
Sequence similarities
Belongs to the CCBE1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length401
- Mass (Da)43,849
- Last updated2009-05-05 v2
- Checksum27F2BB0FF261DCBC
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M6YWX1 | A0A8M6YWX1_DANRE | ccbe1 | 328 | ||
A0A8M9P3B9 | A0A8M9P3B9_DANRE | ccbe1 | 359 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC154643 EMBL· GenBank· DDBJ | AAI54644.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |