A8J637 · PETS_CHLRE
- ProteinPolyprotein of EF-Ts, chloroplastic
- GenePETs
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1013 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Elongation factor Ts, chloroplastic
Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP (PubMed:15548736).
It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome (PubMed:15548736).
It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome (PubMed:15548736).
Plastid-specific ribosomal protein-7, chloroplastic
Binds to psbD and psbA mRNAs 5'-untranslated regions (UTRs) in vitro.
Miscellaneous
Plastid-specific ribosomal protein-7, chloroplastic
65 kDa protein PSRP-7 is the major form.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast ribosome | |
Cellular Component | mitochondrion | |
Molecular Function | mRNA binding | |
Molecular Function | translation elongation factor activity | |
Molecular Function | translation elongation factor binding | |
Biological Process | mitochondrial translational elongation | |
Biological Process | response to light stimulus |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended namePolyprotein of EF-Ts, chloroplastic
- Short names110 kDa pro-protein
- Cleaved into 2 chains
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > core chlorophytes > Chlorophyceae > CS clade > Chlamydomonadales > Chlamydomonadaceae > Chlamydomonas
Accessions
- Primary accessionA8J637
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-43 | Chloroplast | ||||
Sequence: MLRELGRTATVKAHGRSVLRPVRGPAGRRQVAFTGVRPSVRVF | ||||||
Chain | PRO_0000449220 | 44-559 | Plastid-specific ribosomal protein-7, chloroplastic | |||
Sequence: AEAPAAEQAAKAIKLEDVKEGSEYEGTVTTVEEFGAFVNFGANTNGLVHISKLASGFTKNAKDVVQPGQKVTVKVLSVDAEKKRVSLELKSAVAAEASAEESDDIITEPDREGADATDDDEDVEVELEDGQVEVRADLPGFEDIPFVMEEADMDAEMSEAAIAALEADLDGAEIRYELEAPAYMEEVTGKVARIEDYGVFLEFEWNGKTLTGLLAKDEMKVPSSALSAEAQAALRAEWADTGFEMPAFVELPDDELDVKKYYQPGESVPAFVLESSLVDGRGISLTHFTDEEVSAEAVAAYEELEDDEDEELDKMMADAAGLEDEVLAFDPEALMEEDEGEEAGAAADAGDDAEYEGVSADGLEGANGNYALGATRSGLIKGKNGYQVAPMGLPSRPLNDAVTSSGLAILGTSEVDFDGDEVQLVDYWTSEAFDNIPKDVLKKLGLKMSYTEAGEAEFEERADFEATDVPFYLYGGDVESRAKEFVADLLSDDVDEAELPARAGRAPIVLAAAVQN | ||||||
Chain | PRO_0000449219 | 44-1013 | Polyprotein of EF-Ts, chloroplastic | |||
Sequence: AEAPAAEQAAKAIKLEDVKEGSEYEGTVTTVEEFGAFVNFGANTNGLVHISKLASGFTKNAKDVVQPGQKVTVKVLSVDAEKKRVSLELKSAVAAEASAEESDDIITEPDREGADATDDDEDVEVELEDGQVEVRADLPGFEDIPFVMEEADMDAEMSEAAIAALEADLDGAEIRYELEAPAYMEEVTGKVARIEDYGVFLEFEWNGKTLTGLLAKDEMKVPSSALSAEAQAALRAEWADTGFEMPAFVELPDDELDVKKYYQPGESVPAFVLESSLVDGRGISLTHFTDEEVSAEAVAAYEELEDDEDEELDKMMADAAGLEDEVLAFDPEALMEEDEGEEAGAAADAGDDAEYEGVSADGLEGANGNYALGATRSGLIKGKNGYQVAPMGLPSRPLNDAVTSSGLAILGTSEVDFDGDEVQLVDYWTSEAFDNIPKDVLKKLGLKMSYTEAGEAEFEERADFEATDVPFYLYGGDVESRAKEFVADLLSDDVDEAELPARAGRAPIVLAAAVQNISAAEVKALREKTGAGMMDCKKALAECAGDAEAAAEWLRKKGLSGADKKAGRIAAEGAVARYIHPGSRLGVLLEVNCETDFVAASEKFQALVNELGMIIAATDCICVSPEDVPEEVLAKEREVEMGKEDLANKPEAIRAKIVEGRLQKMRDQVALTNQATLSNPDKTVAELVKETIAAVGENVKIRRFIKYRLGEGLEKKANDFAAEVAQQTQAKAAAPAAPKKEEPKKEEPKKATVAVSAGTVKELRDKTGAGMMDCKKALAENENDMEKATEWLRMKGLAGADKKAGRIAAEGVVASYIHPGSRLGVLLEVNCETDFVAASEKFNELVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGRAKKIATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFAAEVAAATGAK | ||||||
Chain | PRO_0000449221 | 560-1013 | Elongation factor Ts, chloroplastic | |||
Sequence: ISAAEVKALREKTGAGMMDCKKALAECAGDAEAAAEWLRKKGLSGADKKAGRIAAEGAVARYIHPGSRLGVLLEVNCETDFVAASEKFQALVNELGMIIAATDCICVSPEDVPEEVLAKEREVEMGKEDLANKPEAIRAKIVEGRLQKMRDQVALTNQATLSNPDKTVAELVKETIAAVGENVKIRRFIKYRLGEGLEKKANDFAAEVAQQTQAKAAAPAAPKKEEPKKEEPKKATVAVSAGTVKELRDKTGAGMMDCKKALAENENDMEKATEWLRMKGLAGADKKAGRIAAEGVVASYIHPGSRLGVLLEVNCETDFVAASEKFNELVNYIAMGIVAGQNVQYVSADEIPAEVFEREKQLEMARDDLKGKPDAIRAKIAEGRAKKIATEMCLLDQPFLTDPSKTVAEAIKESIAAIGEKISVRRFVKFQLGEGLEKKSNDFAAEVAAATGAK |
Proteomic databases
Expression
Induction
Polyprotein of EF-Ts, chloroplastic
Visible only at the end of the dark period, in 12 hours light/ 12 hours dark conditions (at protein level) (PubMed:15548736).
Induced transiently upon shifting to light; mostly expressed after shifting to light, to a lower extent at the end of the dark period and under continuous light, and at low levels at the end of the light period (PubMed:15548736).
Induced transiently upon shifting to light; mostly expressed after shifting to light, to a lower extent at the end of the dark period and under continuous light, and at low levels at the end of the light period (PubMed:15548736).
Isoform 2
Induced transiently upon shifting to light; mostly expressed after shifting to light, tand at low levels at the end of the light and dark periods and under continuous light.
Isoform 3
Induced transiently upon shifting to light; mostly expressed after shifting to light, to a lower extent at the end of the dark period and under continuous light, and at low levels at the end of the light period.
Plastid-specific ribosomal protein-7, chloroplastic
Expressed constitutively in both continuous light, and 12 hours light/ 12 hours dark conditions (at protein level).
Elongation factor Ts, chloroplastic
Expressed constitutively in both continuous light, and 12 hours light/ 12 hours dark conditions (at protein level).
Gene expression databases
Interaction
Subunit
Plastid-specific ribosomal protein-7, chloroplastic
Component of the chloroplast ribosome 30S and 70S subunits, as well as polysomes.
Polyprotein of EF-Ts, chloroplastic
Component of the chloroplast ribosome 70S subunit, and at low levels, present in polysomes.
Elongation factor Ts, chloroplastic
Associates transiently with chloroplast polysomes.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 64-133 | S1 motif 1 | ||||
Sequence: GSEYEGTVTTVEEFGAFVNFGANTNGLVHISKLASGFTKNAKDVVQPGQKVTVKVLSVDAEKKRVSLELK | ||||||
Region | 141-163 | Disordered | ||||
Sequence: SAEESDDIITEPDREGADATDDD | ||||||
Compositional bias | 144-163 | Acidic residues | ||||
Sequence: ESDDIITEPDREGADATDDD | ||||||
Domain | 227-331 | S1 motif 2 | ||||
Sequence: MEEVTGKVARIEDYGVFLEFEWNGKTLTGLLAKDEMKVPSSALSAEAQAALRAEWADTGFEMPAFVELPDDELDVKKYYQPGESVPAFVLESSLVDGRGISLTHF | ||||||
Region | 772-798 | Disordered | ||||
Sequence: QAKAAAPAAPKKEEPKKEEPKKATVAV | ||||||
Compositional bias | 780-794 | Basic and acidic residues | ||||
Sequence: APKKEEPKKEEPKKA |
Sequence similarities
Elongation factor Ts, chloroplastic
Belongs to the EF-Ts family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
A8J637-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Synonyms110 kDa pro-protein
- Length1,013
- Mass (Da)108,770
- Last updated2007-12-04 v1
- Checksum5478E2AA7FDE601C
A8J637-2
- Name2
- Synonyms79 kDa protein PSRP-7
A8J637-3
- Name3
- Synonyms61 kDa protein PSRP-7
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2K3D3Y7 | A0A2K3D3Y7_CHLRE | EFTS | 428 | ||
A0A2K3D3Y8 | A0A2K3D3Y8_CHLRE | EFTS | 1093 | ||
A8J641 | A8J641_CHLRE | CHLRE_12g519180v5 | 560 |
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 144-163 | Acidic residues | ||||
Sequence: ESDDIITEPDREGADATDDD | ||||||
Sequence conflict | 334 | in Ref. 1; AAU93598 | ||||
Sequence: E → K | ||||||
Alternative sequence | VSP_060527 | 559-560 | in isoform 3 | |||
Sequence: NI → SQ | ||||||
Alternative sequence | VSP_060528 | 561-1013 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_060529 | 596-603 | in isoform 2 | |||
Sequence: WLRKKGLS → VGKRAGFF | ||||||
Alternative sequence | VSP_060530 | 604-1013 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 780-794 | Basic and acidic residues | ||||
Sequence: APKKEEPKKEEPKKA |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY661459 EMBL· GenBank· DDBJ | AAU93598.1 EMBL· GenBank· DDBJ | mRNA | ||
CM008973 EMBL· GenBank· DDBJ | PNW75255.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DS496138 EMBL· GenBank· DDBJ | EDP00635.1 EMBL· GenBank· DDBJ | Genomic DNA |