A8IYS6 · CF300_CHLRE
- ProteinCilia- and flagella-associated protein 300
- GeneCFAP300
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids257 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Plays a role in outer and inner dynein arm assembly.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoskeleton | |
Cellular Component | motile cilium |
Names & Taxonomy
Protein names
- Recommended nameCilia- and flagella-associated protein 300
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > core chlorophytes > Chlorophyceae > CS clade > Chlamydomonadales > Chlamydomonadaceae > Chlamydomonas
Accessions
- Primary accessionA8IYS6
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes predominantly in the cytoplasm and weakly in flagella. Transported to the flagellar matrix in an intraflagellar transport (IFT)-dependent manner.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000444630 | 1-257 | Cilia- and flagella-associated protein 300 | |||
Sequence: MTAFVPVSLPSTSALNDAYVKSQLTKWDLLRNLRCVAVRYTKYYHKLQGQELLADLFRDEKVQEAFQVLRKGGAWGQLGGPVTKVDATLLASSLTRMDLFDKLTETSPPIVRSNGDIGKCMEDNREGFQVSDQLRELILVEESEHAALFSEAERDELLWRLFEHVVLGGACCQFEDKVEPYVETSKRLYKELVCAQKDPATGKVQTVSAVYKINSIQGDSGPLELYPSRSRQNFCYAAVDPVRRIVKILYHAYVPYW |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the CFAP300 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length257
- Mass (Da)29,163
- Last updated2007-12-04 v1
- ChecksumC2E9FFA92A8E0A67
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DS496127 EMBL· GenBank· DDBJ | EDP02986.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM008973 EMBL· GenBank· DDBJ | PNW75890.1 EMBL· GenBank· DDBJ | Genomic DNA |