A6YFB5 · HTRA1_XENLA
- ProteinSerine protease HTRA1
- Genehtra1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids459 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Serine protease with a variety of targets, including extracellular matrix proteins and proteoglycans such as biglycan, syndecan-4 and glypican-4. Through cleavage of proteoglycans, may release soluble FGF-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. Consequently, facilitates inductive processes in the developing embryo, such as posteriorization, mesoderm induction and neuronal differentiation. Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Inhibits signaling mediated by TGF-beta family members. Consequently, may regulate many physiological processes. Intracellularly, degrades TSC2, leading to the activation of TSC2 downstream targets.
Features
Showing features for site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 148 | Involved in trimer stabilization | ||||
Sequence: Y | ||||||
Site | 150 | Involved in trimer stabilization | ||||
Sequence: F | ||||||
Active site | 199 | Charge relay system | ||||
Sequence: H | ||||||
Active site | 229 | Charge relay system | ||||
Sequence: D | ||||||
Site | 257 | Involved in trimer stabilization | ||||
Sequence: F | ||||||
Active site | 307 | Charge relay system | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | extracellular region | |
Cellular Component | plasma membrane | |
Molecular Function | growth factor binding | |
Molecular Function | serine-type endopeptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSerine protease HTRA1
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionA6YFB5
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly secreted. Also found associated with the plasma membrane.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 307 | Loss of activity. | ||||
Sequence: S → A |
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MTMLWLAVLLTCGAPAAL | ||||||
Chain | PRO_0000416254 | 19-459 | Serine protease HTRA1 | |||
Sequence: LPTSGVGCPARCDPSSCSPAPTNCQSGETALRCGCCSVCAAAENERCGEGPEDPLCASGLRCVRNGGVTRCQCPSNQPVCGSDGKTYSSLCRLQAESKAVQGRGVAAIIPIQRGDCQQGQKDPDSPRYKYNFIADVVEKIAPAVVHIELFRILPFFKREVPAASGSGFIVSEDGLILTNAHVVTNKHRLKVERSDGSTYDAQIIDVDEKADIALIKIKAKGKLPVLLLGRSEELRPGEFVVAIGSPFSLQNTVTTGIVSTAQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVVGINTLKVTAGISFAIPSDKIRKFMAESHNRQSTGQGTKKKKYLGIRMMSLSQGKLKELKEQVKDFPENTSGAYIVEVLPDTPAEEAGLKEGDIIISISGKTVTSSSEVSEAIKKEGTLQMVIRRGNEDIPISVTPKEIEF | ||||||
Disulfide bond | 26↔51 | |||||
Sequence: CPARCDPSSCSPAPTNCQSGETALRC | ||||||
Disulfide bond | 30↔53 | |||||
Sequence: CDPSSCSPAPTNCQSGETALRCGC | ||||||
Disulfide bond | 35↔54 | |||||
Sequence: CSPAPTNCQSGETALRCGCC | ||||||
Disulfide bond | 42↔57 | |||||
Sequence: CQSGETALRCGCCSVC | ||||||
Disulfide bond | 65↔80 | |||||
Sequence: CGEGPEDPLCASGLRC | ||||||
Disulfide bond | 74↔89 | |||||
Sequence: CASGLRCVRNGGVTRC | ||||||
Disulfide bond | 91↔109 | |||||
Sequence: CPSNQPVCGSDGKTYSSLC | ||||||
Disulfide bond | 98↔134 | |||||
Sequence: CGSDGKTYSSLCRLQAESKAVQGRGVAAIIPIQRGDC |
Keywords
- PTM
Expression
Induction
Up-regulated by FGF4 and FGF8.
Developmental stage
First detected after midblastula transition. Expression increases during gastrulation and neurulation. Expressed in the blastopore lip at gastrula stage (stage 11), the posterior mesoderm and anterior neural plate after involution (stage 14), the early forebrain and midbrain-hindbrain boundary at the neurula stage (stage 16), and the branchial arch region in tail bud stage embryos (stage 26).
Gene expression databases
Interaction
Subunit
Forms homotrimers. In the presence of substrate, may form higher-order multimers in a PDZ-independent manner.
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-92 | IGFBP N-terminal | ||||
Sequence: SGVGCPARCDPSSCSPAPTNCQSGETALRCGCCSVCAAAENERCGEGPEDPLCASGLRCVRNGGVTRCQCP | ||||||
Domain | 74-136 | Kazal-like | ||||
Sequence: CASGLRCVRNGGVTRCQCPSNQPVCGSDGKTYSSLCRLQAESKAVQGRGVAAIIPIQRGDCQQ | ||||||
Region | 183-343 | Serine protease | ||||
Sequence: GSGFIVSEDGLILTNAHVVTNKHRLKVERSDGSTYDAQIIDVDEKADIALIKIKAKGKLPVLLLGRSEELRPGEFVVAIGSPFSLQNTVTTGIVSTAQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVVGINTLKVTAGISFAIPSDKIRKFM | ||||||
Domain | 344-446 | PDZ | ||||
Sequence: AESHNRQSTGQGTKKKKYLGIRMMSLSQGKLKELKEQVKDFPENTSGAYIVEVLPDTPAEEAGLKEGDIIISISGKTVTSSSEVSEAIKKEGTLQMVIRRGNE |
Sequence similarities
Belongs to the peptidase S1C family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length459
- Mass (Da)48,991
- Last updated2007-08-21 v1
- Checksum8E6CB4EA02BD3FDB
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 62 | in Ref. 2; AAH87471 | ||||
Sequence: N → W |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EF490997 EMBL· GenBank· DDBJ | ABR68659.1 EMBL· GenBank· DDBJ | mRNA | ||
BC087471 EMBL· GenBank· DDBJ | AAH87471.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |