A6P7H6 · FGF13_XENLA
- ProteinFibroblast growth factor 13
- Genefgf13
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids245 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules (By similarity).
Through its action on microtubules, may participate in the refinement of axons by negatively regulating axonal and leading processes branching (By similarity).
Plays a crucial role in neuron polarization and migration (By similarity).
Regulates voltage-gated sodium channel transport and function (By similarity).
Required for proper head development, it is involved in neural differentiation through regulation of the mek5-erk5 pathway (PubMed:17584734).
Through its action on microtubules, may participate in the refinement of axons by negatively regulating axonal and leading processes branching (By similarity).
Plays a crucial role in neuron polarization and migration (By similarity).
Regulates voltage-gated sodium channel transport and function (By similarity).
Required for proper head development, it is involved in neural differentiation through regulation of the mek5-erk5 pathway (PubMed:17584734).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameFibroblast growth factor 13
- Short namesFGF-13; xFGF13
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionA6P7H6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Not secreted. Localizes to the lateral membrane and intercalated disks of myocytes.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000419209 | 1-245 | Fibroblast growth factor 13 | |||
Sequence: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGNCEKNKLNVFSRVKLFGSKKRRRRRPEPQLKGIVTKLYSRQGYHLQLQPDGTIDGAKEEESSATVFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSEHFTPECKFKESVFENYYVTYSSMIYRQQHSGRSWFLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSQNDST |
Expression
Developmental stage
Expressed maternally. Zygotic expression is observed at neurula and tailbud stages. Widely expressed in the presumptive ectoderm during blastula, and in the dorsal structures during neurula and tailbud stages. At tailbud stages, strongly expressed in the ventral region of neural tube. Isoform 1 is expressed weakly at neurula and strongly at tailbud stage. Isoform 2 and isoform 3 are strongly expressed at the tailbud stage.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-37 | Disordered | ||||
Sequence: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGN | ||||||
Region | 1-62 | Mediates targeting to the nucleus | ||||
Sequence: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGNCEKNKLNVFSRVKLFGSKKRRRRRP | ||||||
Region | 213-245 | Disordered | ||||
Sequence: TEFSRSGSGTPTKSRSVSGVLNGGKSMSQNDST |
Sequence similarities
Belongs to the heparin-binding growth factors family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
A6P7H6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsxFGF13-S
- Length245
- Mass (Da)27,519
- Last updated2007-08-21 v1
- Checksum88FBC2D43543E0FB
A6P7H6-2
- Name2
- SynonymsxFGF13-V
- Differences from canonical
- 1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGNCEKNKLNVFSRVKLFGSKKRRRRRP → MSGKVIKPKEEKDASK
A6P7H6-3
- Name3
- SynonymsxFGF13-VY
- Differences from canonical
- 1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGNCEKNKLNVFSRVKLFGSKKRRRRRP → MSGKVIKPKEEKDASKVLDDAPPGTQEYIMLRQDSIQSADLKKKESPFRAKCHEIFCCPLKQVHLKEHTEPE
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_044134 | 1-62 | in isoform 2 | |||
Sequence: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGNCEKNKLNVFSRVKLFGSKKRRRRRP → MSGKVIKPKEEKDASK | ||||||
Alternative sequence | VSP_044135 | 1-62 | in isoform 3 | |||
Sequence: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKSKGNCEKNKLNVFSRVKLFGSKKRRRRRP → MSGKVIKPKEEKDASKVLDDAPPGTQEYIMLRQDSIQSADLKKKESPFRAKCHEIFCCPLKQVHLKEHTEPE |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB308062 EMBL· GenBank· DDBJ | BAF66271.1 EMBL· GenBank· DDBJ | mRNA | ||
AB308063 EMBL· GenBank· DDBJ | BAF66272.1 EMBL· GenBank· DDBJ | mRNA | ||
BC076721 EMBL· GenBank· DDBJ | AAH76721.1 EMBL· GenBank· DDBJ | mRNA |