A6NGQ2 · OOEP_HUMAN
- ProteinOocyte-expressed protein homolog
- GeneOOEP
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids149 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
As part of the OOEP-KHDC3L scaffold, recruits BLM and TRIM25 to DNA replication forks, thereby promoting the ubiquitination of BLM by TRIM25, enhancing BLM retainment at replication forks and therefore promoting stalled replication fork restart (By similarity).
Positively regulates the homologous recombination-mediated DNA double-strand break (DSB) repair pathway by regulating ATM activation and RAD51 recruitment to DSBs in oocytes (By similarity).
Thereby contributes to oocyte survival and the resumption and completion of meiosis (By similarity).
As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics (By similarity).
Required for the formation of F-actin cytoplasmic lattices in oocytes which in turn are responsible for symmetric division of zygotes via the regulation of mitotic spindle formation and positioning (By similarity).
Positively regulates the homologous recombination-mediated DNA double-strand break (DSB) repair pathway by regulating ATM activation and RAD51 recruitment to DSBs in oocytes (By similarity).
Thereby contributes to oocyte survival and the resumption and completion of meiosis (By similarity).
As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics (By similarity).
Required for the formation of F-actin cytoplasmic lattices in oocytes which in turn are responsible for symmetric division of zygotes via the regulation of mitotic spindle formation and positioning (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | protein-containing complex | |
Cellular Component | subcortical maternal complex | |
Molecular Function | RNA binding | |
Biological Process | actin filament organization | |
Biological Process | embryonic pattern specification | |
Biological Process | establishment of spindle localization | |
Biological Process | establishment or maintenance of apical/basal cell polarity | |
Biological Process | positive regulation of double-strand break repair | |
Biological Process | positive regulation of double-strand break repair via homologous recombination | |
Biological Process | positive regulation of meiotic nuclear division | |
Biological Process | regulation of cell division | |
Biological Process | regulation of establishment of protein localization | |
Biological Process | regulation of protein localization | |
Biological Process | replication fork processing |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOocyte-expressed protein homolog
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA6NGQ2
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_042523 | 18 | in dbSNP:rs2280286 | |||
Sequence: A → T | ||||||
Natural variant | VAR_088459 | 37 | found in female infertility with early embryonic arrest; uncertain significance; dbSNP:rs189355507 | |||
Sequence: R → G | ||||||
Natural variant | VAR_088460 | 37 | found in female infertility with early embryonic arrest; uncertain significance; dbSNP:rs768361697 | |||
Sequence: R → P | ||||||
Natural variant | VAR_042524 | 92 | in dbSNP:rs496530 | |||
Sequence: V → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 229 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000328802 | 1-149 | Oocyte-expressed protein homolog | |||
Sequence: MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLADELFGPDRAIIPEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQDPVA |
Proteomic databases
Expression
Developmental stage
Expressed in oocytes of the fetal ovary (PubMed:25542835).
Expressed primarily with other SCMC components in the subcortex of oocytes and early embryos (PubMed:25542835).
Expression is excluded from cell-cell contact regions after the 2-cell stage (PubMed:25542835).
Expressed primarily with other SCMC components in the subcortex of oocytes and early embryos (PubMed:25542835).
Expression is excluded from cell-cell contact regions after the 2-cell stage (PubMed:25542835).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the subcortical maternal complex (SCMC), at least composed of NLRP5, KHDC3L, OOEP, and TLE6 isoform 1 (PubMed:25542835, PubMed:26537248).
Within the complex, interacts with NLRP5, KHDC3L and TLE6 isoform 1 (PubMed:25542835, PubMed:26537248).
As part of the SCMC interacts with the SCMC-associated protein NLRP4F (By similarity).
The SCMC may facilitate translocation of its components between the nuclear and cytoplasmic compartments (PubMed:25542835).
Forms a scaffold complex with KHDC3L/FILIA, and interacts with BLM and TRIM25 at DNA replication forks (By similarity).
Within the complex, interacts with NLRP5, KHDC3L and TLE6 isoform 1 (PubMed:25542835, PubMed:26537248).
As part of the SCMC interacts with the SCMC-associated protein NLRP4F (By similarity).
The SCMC may facilitate translocation of its components between the nuclear and cytoplasmic compartments (PubMed:25542835).
Forms a scaffold complex with KHDC3L/FILIA, and interacts with BLM and TRIM25 at DNA replication forks (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | A6NGQ2 | ABI2 Q9NYB9-2 | 3 | EBI-18583589, EBI-11096309 | |
BINARY | A6NGQ2 | AIRIM Q9NX04 | 3 | EBI-18583589, EBI-8643161 | |
BINARY | A6NGQ2 | ALOX5 P09917 | 3 | EBI-18583589, EBI-79934 | |
BINARY | A6NGQ2 | ENKD1 Q9H0I2 | 3 | EBI-18583589, EBI-744099 | |
BINARY | A6NGQ2 | KHDC3L Q587J8 | 3 | EBI-18583589, EBI-22731520 | |
BINARY | A6NGQ2 | KIF9 Q9HAQ2 | 3 | EBI-18583589, EBI-8472129 | |
BINARY | A6NGQ2 | LONRF1 Q17RB8 | 3 | EBI-18583589, EBI-2341787 | |
BINARY | A6NGQ2 | NLRP5 P59047 | 2 | EBI-18583589, EBI-11071382 | |
BINARY | A6NGQ2 | NTAQ1 Q96HA8 | 3 | EBI-18583589, EBI-741158 | |
BINARY | A6NGQ2 | SNRPB P14678-2 | 3 | EBI-18583589, EBI-372475 | |
BINARY | A6NGQ2 | TCEANC Q8N8B7-2 | 3 | EBI-18583589, EBI-11955057 | |
BINARY | A6NGQ2 | TLE6 Q9H808-1 | 2 | EBI-18583589, EBI-32711753 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MVDDAGAAESQRGKQTPAHSLE | ||||||
Domain | 49-110 | KH; atypical | ||||
Sequence: PLVFYLEAWLADELFGPDRAIIPEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSML |
Domain
Contains an atypical KH domain with amino acid changes at critical sites, suggesting that it may not bind RNA.
Sequence similarities
Belongs to the KHDC1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length149
- Mass (Da)17,170
- Last updated2010-10-05 v3
- ChecksumE7C726FB46909404
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EU290647 EMBL· GenBank· DDBJ | ABX84389.1 EMBL· GenBank· DDBJ | mRNA | ||
AC019205 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |