A6JZ88 · A6JZ88_RAT
- ProteinAldo-keto reductase family 1 member A1
- GeneAkr1a1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids325 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
Catalytic activity
- 3-deoxyfructose + NADP+ = 3-deoxyglucosone + H+ + NADPH
- H+ + NADPH + S-nitroso-CoA = NADP+ + sulfinamide-CoAThis reaction proceeds in the forward direction.
- H+ + NADPH + S-nitrosoglutathione = NADP+ + S-(hydroxysulfenamide)glutathione
- hydroxyacetone + NADP+ = H+ + methylglyoxal + NADPH
Features
Showing features for active site, site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 50 | Proton donor | ||||
Sequence: Y | ||||||
Site | 80 | Lowers pKa of active site Tyr | ||||
Sequence: K | ||||||
Binding site | 113 | substrate | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | cytosol | |
Molecular Function | alcohol dehydrogenase (NADP+) activity | |
Biological Process | aldehyde catabolic process |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAldo-keto reductase family 1 member A1
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionA6JZ88
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-293 | NADP-dependent oxidoreductase | ||||
Sequence: IGLGTWKSEPGQVKAAIKYALSVGYRHIDCASVYGNETEIGEALKESVGAGKAVPREELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVKYDSTHYKETWKALEALVAKGLVKALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTFSPEEMKQLDALN |
Sequence similarities
Belongs to the aldo/keto reductase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length325
- Mass (Da)36,506
- Last updated2023-06-28 v1
- ChecksumF95573B7411884DA
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CH474008 EMBL· GenBank· DDBJ | EDL90265.1 EMBL· GenBank· DDBJ | Genomic DNA |