A6HT01 · A6HT01_RAT

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular ComponentCul2-RING ubiquitin ligase complex
Cellular ComponentCul3-RING ubiquitin ligase complex
Cellular ComponentCul4A-RING E3 ubiquitin ligase complex
Cellular ComponentCul4B-RING E3 ubiquitin ligase complex
Cellular ComponentCul5-RING ubiquitin ligase complex
Cellular ComponentCul7-RING ubiquitin ligase complex
Cellular Componentcullin-RING ubiquitin ligase complex
Cellular Componentcytoplasm
Cellular Componentcytosol
Cellular Componentnucleus
Cellular ComponentSCF ubiquitin ligase complex
Cellular ComponentVCB complex
Molecular Functioncullin family protein binding
Molecular Functionmolecular adaptor activity
Molecular FunctionNEDD8 ligase activity
Molecular Functionprotein-containing complex binding
Molecular FunctionRNA polymerase II-specific DNA-binding transcription factor binding
Molecular Functionubiquitin protein ligase activity
Molecular Functionubiquitin protein ligase binding
Molecular Functionubiquitin-ubiquitin ligase activity
Biological Processcellular response to amino acid stimulus
Biological Processcellular response to UV
Biological ProcessDNA damage response
Biological Processnegative regulation of response to oxidative stress
Biological Processnegative regulation of type I interferon production
Biological Processpositive regulation of canonical NF-kappaB signal transduction
Biological Processpositive regulation of proteasomal ubiquitin-dependent protein catabolic process
Biological Processpositive regulation of protein autoubiquitination
Biological Processpositive regulation of protein catabolic process
Biological Processpositive regulation of TORC1 signaling
Biological Processproteasome-mediated ubiquitin-dependent protein catabolic process
Biological Processprotein catabolic process
Biological Processprotein K48-linked ubiquitination
Biological Processprotein monoubiquitination
Biological Processprotein neddylation
Biological Processprotein polyubiquitination
Biological Processprotein ubiquitination
Biological ProcessSCF-dependent proteasomal ubiquitin-dependent protein catabolic process
Biological Processspermatogenesis
Biological ProcessT cell activation
Biological Processubiquitin-dependent protein catabolic process
Biological Processubiquitin-dependent protein catabolic process via the C-end degron rule pathway

Names & Taxonomy

Protein names

  • Submitted names
    • Ring-box 1, isoform CRA_b

Gene names

    • Name
      Rbx1
    • ORF names
      rCG_60200

Organism names

  • Taxonomic identifier
  • Organism
  • Strains
    • BN
    • Sprague-Dawley
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus

Accessions

  • Primary accession
    A6HT01

Proteomes

Organism-specific databases

Family & Domains

Features

Showing features for region.

TypeIDPosition(s)Description
Region33-54Disordered

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    67
  • Mass (Da)
    7,035
  • Last updated
    2023-06-28 v1
  • Checksum
    697D822165C449E4
MWIPPAAPTAARARSALKLKSTLFISTASLGGSKPGRCAPWTTESGSSKSMGIRKDSPVKLTHLLLV

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
CH473950
EMBL· GenBank· DDBJ
EDM15721.1
EMBL· GenBank· DDBJ
Genomic DNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp