A5PMS9 · A5PMS9_DANRE
- ProteinAP complex subunit beta
- Geneap1b1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids947 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | clathrin adaptor complex | |
Molecular Function | clathrin binding | |
Biological Process | detection of mechanical stimulus involved in sensory perception | |
Biological Process | endocytosis | |
Biological Process | hair cell differentiation | |
Biological Process | inner ear development | |
Biological Process | intracellular protein transport | |
Biological Process | neuromast development | |
Biological Process | regulation of protein localization to plasma membrane | |
Biological Process | vesicle-mediated transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAP complex subunit beta
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA5PMS9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 585-622 | Disordered | ||||
Sequence: SRGVQHKRLPARAGSGESAESPEVGQSGTSEAPPAVIP | ||||||
Compositional bias | 604-618 | Polar residues | ||||
Sequence: ESPEVGQSGTSEAPP | ||||||
Domain | 717-827 | Clathrin adaptor alpha/beta/gamma-adaptin appendage Ig-like subdomain | ||||
Sequence: YVAPKTLFLPAMKAKGLEISGTFARRGGIIQMDLSLTNKAMSVMTDFAIQFNRNSFGLAPAGPLQVLTPLTPNQTIDVSLPLGTTGPVMKMEPLNNLQVAVKNNIDVFYFS | ||||||
Domain | 836-946 | Beta-adaptin appendage C-terminal subdomain | ||||
Sequence: FVEDGKMERQVFLATWKDIPNDNEAQFQIKDVHLNSDAASNKLQGSNIFTIAKRTVDAQDMLYQSIKLTNGIWVLAEMRVQTGNPNYTLSIKCRAPEVSQFVYQCYELVLK |
Sequence similarities
Belongs to the adaptor complexes large subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length947
- Mass (Da)104,247
- Last updated2007-07-10 v1
- Checksum089462D89F914D61
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M3AZG4 | A0A8M3AZG4_DANRE | ap1b1 | 995 | ||
A0A8M9PKD8 | A0A8M9PKD8_DANRE | ap1b1 | 973 | ||
A0A8M3AS47 | A0A8M3AS47_DANRE | ap1b1 | 988 | ||
A0A8M3B9I1 | A0A8M3B9I1_DANRE | ap1b1 | 979 | ||
A0A8M2BCC8 | A0A8M2BCC8_DANRE | ap1b1 | 966 | ||
A0A8M2BCE3 | A0A8M2BCE3_DANRE | ap1b1 | 992 | ||
A0A8M2BCH0 | A0A8M2BCH0_DANRE | ap1b1 | 963 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 604-618 | Polar residues | ||||
Sequence: ESPEVGQSGTSEAPP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX664747 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |